KEGG   Ailuropoda melanoleuca (giant panda): 100473305
Entry
100473305         CDS       T01329                                 

Gene name
PDPK1
Definition
(RefSeq) 3-phosphoinositide-dependent protein kinase 1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01524  Platinum drug resistance
aml03320  PPAR signaling pathway
aml04068  FoxO signaling pathway
aml04071  Sphingolipid signaling pathway
aml04140  Autophagy - animal
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04210  Apoptosis
aml04510  Focal adhesion
aml04660  T cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04722  Neurotrophin signaling pathway
aml04910  Insulin signaling pathway
aml04919  Thyroid hormone signaling pathway
aml04931  Insulin resistance
aml04960  Aldosterone-regulated sodium reabsorption
aml05145  Toxoplasmosis
aml05205  Proteoglycans in cancer
aml05213  Endometrial cancer
aml05215  Prostate cancer
aml05223  Non-small cell lung cancer
aml05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100473305 (PDPK1)
   04071 Sphingolipid signaling pathway
    100473305 (PDPK1)
   04151 PI3K-Akt signaling pathway
    100473305 (PDPK1)
   04152 AMPK signaling pathway
    100473305 (PDPK1)
   04150 mTOR signaling pathway
    100473305 (PDPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100473305 (PDPK1)
  09143 Cell growth and death
   04210 Apoptosis
    100473305 (PDPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100473305 (PDPK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100473305 (PDPK1)
   04664 Fc epsilon RI signaling pathway
    100473305 (PDPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100473305 (PDPK1)
   03320 PPAR signaling pathway
    100473305 (PDPK1)
   04919 Thyroid hormone signaling pathway
    100473305 (PDPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100473305 (PDPK1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100473305 (PDPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100473305 (PDPK1)
   05231 Choline metabolism in cancer
    100473305 (PDPK1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100473305 (PDPK1)
   05213 Endometrial cancer
    100473305 (PDPK1)
   05223 Non-small cell lung cancer
    100473305 (PDPK1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100473305 (PDPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100473305 (PDPK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100473305 (PDPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100473305 (PDPK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100473305 (PDPK1)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100473305 (PDPK1)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   100473305 (PDPK1)
Membrane trafficking [BR:aml04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    100473305 (PDPK1)
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo YukC
Other DBs
NCBI-GeneID: 100473305
NCBI-ProteinID: XP_019662835
Ensembl: ENSAMEG00000017988
LinkDB
Position
10
AA seq 531 aa
MVRTQTESGTAPAIPSGGSRQGATMDSTAAESRPSTNSLQHTTQPPPQPRKKRPEDFKFG
KILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKL
YFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTAEMVSALEYLHGKGIIHRD
LKPENILLNEDMHIQITDFGTAKVLSPESKQARANSFVGTAQYVSPELLTEKSACKSSDL
WALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYDFPEKFFPKARDLVEKLLVLDATKRL
GCEEMGGYGPLRAHPFFESITWENLQHQTPPKLTAYLPAMSEDDEDCYGNYDNLLSQFGC
MQVSSSSSSHSLSASDAGLPQTTGSNIEQYIHDLDTNSFELDLEFSEDEKRLLLEKQASG
NPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELR
PEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCKKIQEVWRHRYQSHPQAAVQ
NT seq 1596 nt   +upstreamnt  +downstreamnt
atggtgaggacccagactgagtccggcacggcccctgccattcccagcggtggtagcaga
cagggcgccaccatggacagcaccgcggccgagtcccgcccgagcaccaactcgctgcaa
cacaccacacagccgccaccacagcctcggaagaaacggcctgaagacttcaaatttggg
aaaattcttggtgaaggctctttttccacagttgtcctggcccgagaactagcaacctca
agggaatatgctattaaaattctagagaaacgtcacattatcaaagagaacaaggtcccg
tatgtaaccagagagagagacgtgatgtcacgcctggatcacccgttctttgttaaactt
tacttcacatttcaggatgatgaaaagctgtactttggtcttagttatgccaaaaatgga
gaactacttaaatacattcgcaaaattggctcattcgatgagacatgcacccggttttac
acggccgagatggtgtcagctctggagtacttgcatggcaagggcatcattcacagggac
ctgaaacccgaaaacattttgttaaatgaagacatgcacatccagatcacagatttcgga
acagcaaaagtattgtccccggagagtaaacaagccagggccaactcgtttgtaggaaca
gcccagtatgtgtctccagagctgctcacagagaagtcggcctgtaaaagttcagacctt
tgggctctcggatgtataatataccagcttgtggcaggactgccgccttttcgagcggga
aatgaatatcttatatttcagaagatcattaagttggaatatgactttcctgaaaaattc
ttccctaaggcaagagaccttgtggaaaaacttttggttttagatgccacgaagcggtta
ggctgtgaggaaatgggaggctacggccccctgcgagctcatccattcttcgagtccatc
acgtgggagaacctgcagcatcagacgcctccgaagctcactgcctacctgccagccatg
tcagaggacgatgaggactgctacgggaactatgacaacctcctgagccagttcggctgc
atgcaggtgtcctcgtcctcctcctcccactccctgtccgcctcggatgcaggcctgccg
cagacgacgggcagcaacattgagcagtatatccacgacctggacactaattcttttgaa
ctggacttagagttctccgaagatgagaagaggttgttactggagaagcaggccagtgga
aacccttggcaccagtttgtagaaaataacttaatactaaagatgggtcccgtagataag
cgaaagggcttgtttgcacggcgacgacagttactgctcacagaagggccacacttgtat
tatgtggatcctgtcaacaaagtcctgaaaggtgaaattccatggtcacaagaactccga
ccagaggccaagaactttaaaacctttttcgtgcacacgccgaacaggacgtattacctg
atggacccgagtgggaacgctcacaaatggtgcaaaaagatccaggaggtgtggagacac
agataccagagccacccacaggccgccgtgcagtga

DBGET integrated database retrieval system