KEGG   Ailuropoda melanoleuca (giant panda): 100473505
Entry
100473505         CDS       T01329                                 

Gene name
SPINT1
Definition
(RefSeq) kunitz-type protease inhibitor 1
  KO
K15619  Kunitz-type protease inhibitor 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml05202  Transcriptional misregulation in cancer
aml05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100473505 (SPINT1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100473505 (SPINT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aml01002]
    100473505 (SPINT1)
Peptidases and inhibitors [BR:aml01002]
 Peptidase inhibitors
  Family I2: Kunitz - BPTI family
   100473505 (SPINT1)
SSDB
Motif
Pfam: Kunitz_BPTI MANEC Ldl_recept_a
Other DBs
NCBI-GeneID: 100473505
NCBI-ProteinID: XP_011226262
Ensembl: ENSAMEG00000016874
LinkDB
Position
5
AA seq 512 aa
MMARARLSRTRVPAVAVWLLCALDLLGTEAGPPPGPPGLPPGGPCLDRFTAGVPAFVLDT
EASVSNGATFLGSPAVRRGWDCVRACCTTQNCNLALVELPPDRGEDAIVACFLMNCLYEQ
NFVCKFAPREGFVNYLTREVYHSYRELRTQGFGGSRIPKAWAGIDLKVQPQEPLVLKDVE
NTDWYLLQGDTDVRVEKSEPDQVKLWGLKEGTYLFQLTAADSDQPESMTNVTVTVLSPKQ
TEEYCLASSKVGRCRGSFPRWYYDPKEQICKSFVYGGCLGNKNNYLREEECKLACRDVQG
PALDRHRPVCSGTCHPTEFRCRDGCCIDSFLECDDTPDCPDASDEATCEKYTSGFEELQN
IHFRSDKGHCVDLPDTGLCLENIPRWYYNPFSERCARFTYGGCFGNKNNFEEEQQCLASC
RGISKKDVFGLRRESPIANIGSVEMAVAVLLVTCIVVVIALLGYCFFKTQRKEFHRHRPH
PHQLQPPTPASSMVSTTEDTEHLVYNHTTQPL
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgatggcccgcgcccgcctctcccggacccgcgtcccagcagtcgccgtgtggctcctg
tgcgcgctcgatctcctgggcaccgaggctgggccgccgcccgggcctcccgggctgccc
ccgggaggcccctgcctggaccgctttaccgccggggtgcctgccttcgtgctcgatacc
gaggcctcggtcagcaacggggccaccttcctgggctcccccgccgtgcgccgcggctgg
gactgcgtgcgcgcgtgctgcaccacccagaactgcaacctggcgctggtggagctgcct
ccggaccgcggggaggacgccattgtcgcctgcttcctaatgaactgcctctacgagcag
aacttcgtgtgcaagttcgcgcccagggagggcttcgtcaactacctcacgcgcgaggtt
taccactcctaccgcgagctgcggacccagggctttggcgggtcccggatccccaaggcc
tgggcaggcatagacttgaaggtacagccccaggaacccctagtgctgaaggatgtggag
aacacagattggtacctactgcagggtgacacggatgtcagagtagagaagagtgagccg
gaccaggtgaagctgtggggactcaaggaaggcacctacctgttccagctgacagcagcc
gactccgaccagccagagagcatgaccaacgtcacagttaccgtgctgtcccccaagcag
acagaagaatattgcctcgcatccagcaaggtgggccgctgccgcggttccttcccccgc
tggtactacgaccccaaagaacagatttgcaagagttttgtttacggaggctgcttgggc
aacaagaacaactatcttcgggaagaggagtgcaagctggcctgccgggatgtgcaaggc
cccgcactggacaggcaccgtccagtgtgctctggcacctgtcaccccaccgagttccgc
tgccgcgacggctgttgcattgacagcttcctggagtgtgatgacactcccgactgcccc
gatgcctccgacgaggccacctgtgagaaatacaccagtggctttgaggagctccagaac
atccacttccgcagtgacaaagggcactgtgtggacctgccagacacaggcctctgcctg
gagaacatcccacgctggtactacaaccccttcagtgaacgctgtgcccgctttacctat
ggtggctgttttggcaacaagaacaacttcgaggaggagcagcagtgtcttgcgtcctgt
cgcggcatctccaagaaggatgttttcggtctgcggcgggaaagccccatagctaacata
ggctccgtggagatggccgtcgcagtactcctggtcacttgcatcgtggtggtgatagcc
ctattgggttattgcttcttcaagacccagaggaaggaattccacagacaccgcccccac
ccccaccagctccaaccccctacccctgccagctccatggtctccaccacagaggacacg
gagcacctggtctataaccacacaacccagcccctctga

DBGET integrated database retrieval system