KEGG   Ailuropoda melanoleuca (giant panda): 100473701
Entry
100473701         CDS       T01329                                 

Gene name
ZEB1
Definition
(RefSeq) zinc finger E-box-binding homeobox 1
  KO
K09299  zinc finger homeobox protein 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml05202  Transcriptional misregulation in cancer
aml05206  MicroRNAs in cancer
aml05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100473701 (ZEB1)
   05206 MicroRNAs in cancer
    100473701 (ZEB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100473701 (ZEB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100473701 (ZEB1)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    100473701 (ZEB1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-met Homeodomain zf-C2H2_jaz Zn-ribbon_8 zf-C2H2_6 DZR
Other DBs
NCBI-GeneID: 100473701
NCBI-ProteinID: XP_019656538
LinkDB
Position
15
AA seq 905 aa
MTSHKSGRDQRHVTQSGGNRKFKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFS
HSGSYSSHISSKKCISLMPVNGRPRTGLKTPQCSSPSLSASPGSPTRPQIRQKIENKPLQ
EQLSINQIKTEPVDYEFKPIVVASGINCSTPLQNGVFSGGGPLQATSSPQGVVQAVVLPT
VGLVSPISINLSDIQNVLKVAVDGNVIRQVLENNQANLASKEQETINASSIQQGGHSVIS
AISLPLVDQDGTTKIIINYSLEQPSQLQVVPQNLKKENPVPTNSCKSEKLPEDLTVKSEK
DKSFEGGVNDSTCLLCDECPGDINALPELKHYDLKQPSQPPPLPAPEAEKPESSVSSGGD
GNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISV
QSSEPSSPEPGRVNIPAKSNEQPQCTNANEPPDSTAELQSPLKMSDSPVLPAGSPINGSR
SSPPSPSPLNLSSSRNTQGYLYTAESAQEEPQIEPLDLSLPKQQGELLERSTITSVYQNS
VYSVQEEPLNLSCTKKEPQKDSCVTDSEPVVNVIPPSANPINIAIPTVTAQLPTIVAIAD
QNSVPCLRALAANKQTILIPQVAYTYSTTVSPAVQEAPLKVIQPNGNQDERQDTSSEGVS
NVEDQNDSDSTPPKKKMRKTENGMYACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKK
AFKHKHHLIEHMRLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCKREAEERDSAEQE
EAGPEVLASEHAGARASPSQADSDERESLTREEDEDSEKEEEEEEDKEMEELQEEKECEK
PQGEEEEEEEEEMEEEEGEEAENEGEEAKTEGLMKEDDAVNQASSLEQKVSKNSEQVSEE
KTNEA
NT seq 2718 nt   +upstreamnt  +downstreamnt
atgacgtcacataagtcaggaagagatcaaagacatgtgacacagtctgggggcaatcgt
aaattcaagtgcactgaatgtggaaaagctttcaaatacaaacatcatctaaaagagcac
ttaagaatccacagtggagagaagccatatgaatgcccaaactgcaagaaacgtttttcc
cattctggttcctatagctcacacataagcagcaagaaatgtatcagcttgatgcctgtg
aacgggcgaccaagaacaggactcaagacacctcagtgttcctcaccatctctttcggca
tcaccaggcagtcccacacgaccacagatacggcaaaagatagagaacaaaccccttcaa
gagcaactttctataaaccaaattaaaactgaacctgtggattatgaattcaaacccata
gtggttgcttcaggaatcaactgttcaacccctttacagaatggggtttttagcggtggt
ggcccgttacaggcaaccagttctcctcagggtgtggtgcaagctgttgttctgccaaca
gttggtttggtgtctcccataagtatcaatttaagtgatattcagaatgtacttaaagtg
gcagtagatggtaatgtaataaggcaagttttggagaataatcaagccaatcttgcatcc
aaagaacaagaaacaatcaatgcttcatccatacagcaaggcggccattctgttatttct
gccatcagtcttcctttggttgatcaagatgggacaaccaaaattatcattaactacagt
ctggagcagcctagccaacttcaagttgttcctcagaatttaaaaaaagaaaatccagtc
cccacaaacagttgcaaaagtgaaaagttaccagaagatcttactgttaaatcggagaag
gacaaaagctttgaaggaggagtgaacgatagcacttgccttctgtgtgacgaatgtcca
ggagatattaatgcacttccagaattaaagcactatgacctaaagcagccctctcagcct
cctccgctccctgcaccagaagccgagaagcccgagtcctctgtttcatcgggtggtgat
ggcaatttgtctcccagtcaaccacctttaaagaacctcttgtctcttctaaaagcatac
tatgctttgaacgcacaaccaagtgcagaagagctctccaaaattgctgattcagtaaac
ctaccactggatgtagtaaaaaagtggtttgaaaagatgcaagctggacagatttcagtg
cagtcttctgaaccgtcttctcctgaaccaggcagagtaaatatccccgcaaagagcaat
gagcagcctcaatgtacaaatgcaaatgaacccccggacagcacagcagagctgcagagc
cccctgaagatgtctgactccccagttctaccagcgggatcacccatcaatggttccaga
agtagtccaccctccccatcacctctaaacctttcctcatccagaaatacacagggttac
ttgtacacagcagaaagtgcacaagaagagccacaaatagaacctcttgatctttcacta
ccaaagcaacagggagaattattggaaaggtcaaccatcactagtgtttaccagaacagt
gtttattctgtccaggaagaacccttgaacttgtcttgcacaaaaaaggagccacagaag
gacagttgcgttacagactcagaaccagttgtaaatgtgatcccaccaagtgccaacccc
ataaatattgctatacctacggtcactgcccagttacccacaatcgtggccattgctgac
cagaacagtgttccatgcttgcgagcactagctgccaataagcagactattctgattccc
caggtggcttacacatactcgactacagtcagccctgcagtccaggaagcacccttgaaa
gtgatccagccaaatgggaatcaggatgaaaggcaagacactagctcagaaggagtatca
aatgtagaggaccagaatgactctgattccacaccacccaaaaagaaaatgcggaagaca
gagaatggaatgtacgcttgtgatttgtgtgataagatattccaaaagagtagctcacta
ttgagacataaatacgaacacacaggtaagagaccgcatgagtgtggaatctgtaagaag
gcgtttaaacacaaacaccatttgattgaacacatgcggttacattctggagaaaagccc
tatcaatgtgacaaatgtggaaagcgtttctcacactctgggtcttactctcaacacatg
aatcaccgctactcctactgcaagcgggaggcggaggagcgcgacagcgcggagcaggaa
gaggccgggccggaagtcctggccagcgagcacgccggggcccgcgcatctccctcacag
gccgactcggatgagagagagagtctgacgagggaagaggatgaagacagtgaaaaagag
gaggaggaggaggaggacaaagagatggaagaactgcaggaagagaaagaatgtgaaaaa
ccacaaggggaggaggaagaggaggaggaagaggagatggaggaggaggagggggaagag
gcagagaatgagggagaagaggcaaaaactgaaggtctgatgaaggaagatgacgctgta
aatcaagcgagcagcttagaacaaaaagtaagcaagaatagcgagcaggtgtctgaagaa
aaaacaaatgaagcctaa

DBGET integrated database retrieval system