KEGG   Ailuropoda melanoleuca (giant panda): 100473900
Entry
100473900         CDS       T01329                                 

Gene name
CDC20
Definition
(RefSeq) cell division cycle protein 20 homolog
  KO
K03363  cell division cycle 20, cofactor of APC complex
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04110  Cell cycle
aml04114  Oocyte meiosis
aml04120  Ubiquitin mediated proteolysis
aml05166  Human T-cell leukemia virus 1 infection
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100473900 (CDC20)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100473900 (CDC20)
   04114 Oocyte meiosis
    100473900 (CDC20)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100473900 (CDC20)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100473900 (CDC20)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:aml04121]
    100473900 (CDC20)
   03036 Chromosome and associated proteins [BR:aml03036]
    100473900 (CDC20)
Ubiquitin system [BR:aml04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Target recognizing subunit
     100473900 (CDC20)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    100473900 (CDC20)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A Ge1_WD40 ELYS-bb
Other DBs
NCBI-GeneID: 100473900
NCBI-ProteinID: XP_034506608
Ensembl: ENSAMEG00000001637
LinkDB
Position
2
AA seq 499 aa
MAQFVFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTP
GKSSSKAQTTPSKPGGDRYIPHRSASQMEVASFLLSKENQPEDSQTPTKKEHQKAWALNL
NGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPE
IRNDYYLNLVDWSSGNVLAVALDSSVYLWSASSGDILQLLQMEQPGDYVSSVAWIKEGNY
LAVGTSNAEVQLWDVQQQKRLRNMTSHSARVSSLCWNSYIVSSGSRSGHIHHHDVRVAEH
HVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKA
VAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAQSQVCSILWSPHYKELISGHGF
AQNQLVIWKYPTMAKVAELKGHTARVLSLTMSPDGATVASAAADETLRLWRCFELDPARR
REREKASAAKSSLIHQGIR
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggcgcagttcgtgttcgagagtgacctgcactcgctgctgcagctggacgcacctatc
cccaatgcacctccggcgcgctggcagcgcaaagctaaggaagccgcggggccggccccc
tcgcccatgcgggcggccaaccgatcccacagcgccggcaggaccccaggccgaactccc
ggcaaatccagctccaaggctcagaccactcccagcaaacctggcggtgaccgctatatc
ccccatcgcagtgcttcccagatggaggtggccagtttcctcctgagcaaggaaaaccag
cctgaagacagccagacgcccaccaagaaggaacatcagaaagcctgggctttgaacctg
aacggttttgatgtggaggaagccaagatccttcggctcagtggaaaaccacaaaatgcc
ccagagggttaccagaacagactgaaagtgctttacagccagaaggccacgcctggctcc
agccggaagacctgccgttacattccttccctgccagaccgaatcctggatgcccctgaa
atccggaatgactactacctgaaccttgtggactggagctctgggaatgtactggccgtg
gcgttggacagcagcgtgtacttgtggagtgctagctctggtgacatcctgcagctgctg
cagatggagcagcctggggactacgtatcttctgtggcctggatcaaagagggcaactac
ctggctgtgggcaccagcaatgctgaggtgcagctatgggatgtgcagcagcagaagcgg
cttcgaaacatgaccagtcattccgcccgagtgagctccctgtgttggaacagctatatc
gtgtccagtggctcacgttctggccacatccaccaccatgatgttcgggtggcagaacac
catgtggccaccctgagtggccacagccaggaggtgtgtgggctgcgctgggccccagat
ggacgacatttggccagcggtggcaacgataacttggtcaatgtgtggcctagtgctcct
ggagagggcggctgggttcccctgcagacattcactcagcatcaaggggctgtcaaggct
gtagcttggtgtccctggcagtccaatgtcctggcaaccggagggggcaccagcgaccga
cacattcgcatctggaatgtctgctctggggcctgtctgagtgctgtggatgctcaatcc
caggtgtgctccatcctctggtctccccactacaaggagctcatctcaggccacggcttt
gcccagaatcagctggttatttggaagtacccaaccatggccaaggtggccgagcttaaa
ggtcacacggcccgggtcctaagtctgaccatgagcccagatggggccaccgtggcctca
gcagcagcagacgagacactgcggctgtggcgctgctttgagctggaccccgcgcggcgg
cgggagcgggagaaggccagcgcggccaaaagcagcctcatccaccaaggcatccgctga

DBGET integrated database retrieval system