KEGG   Ailuropoda melanoleuca (giant panda): 100473937
Entry
100473937         CDS       T01329                                 

Gene name
BAD
Definition
(RefSeq) bcl2-associated agonist of cell death
  KO
K02158  Bcl-2-antagonist of cell death
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01522  Endocrine resistance
aml01524  Platinum drug resistance
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04140  Autophagy - animal
aml04151  PI3K-Akt signaling pathway
aml04210  Apoptosis
aml04370  VEGF signaling pathway
aml04510  Focal adhesion
aml04722  Neurotrophin signaling pathway
aml04910  Insulin signaling pathway
aml04919  Thyroid hormone signaling pathway
aml05010  Alzheimer disease
aml05014  Amyotrophic lateral sclerosis
aml05020  Prion disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05145  Toxoplasmosis
aml05152  Tuberculosis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05165  Human papillomavirus infection
aml05168  Herpes simplex virus 1 infection
aml05170  Human immunodeficiency virus 1 infection
aml05200  Pathways in cancer
aml05203  Viral carcinogenesis
aml05210  Colorectal cancer
aml05211  Renal cell carcinoma
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05215  Prostate cancer
aml05218  Melanoma
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05223  Non-small cell lung cancer
aml05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100473937 (BAD)
   04014 Ras signaling pathway
    100473937 (BAD)
   04370 VEGF signaling pathway
    100473937 (BAD)
   04024 cAMP signaling pathway
    100473937 (BAD)
   04022 cGMP-PKG signaling pathway
    100473937 (BAD)
   04151 PI3K-Akt signaling pathway
    100473937 (BAD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100473937 (BAD)
  09143 Cell growth and death
   04210 Apoptosis
    100473937 (BAD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100473937 (BAD)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100473937 (BAD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100473937 (BAD)
   04919 Thyroid hormone signaling pathway
    100473937 (BAD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100473937 (BAD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100473937 (BAD)
   05203 Viral carcinogenesis
    100473937 (BAD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100473937 (BAD)
   05212 Pancreatic cancer
    100473937 (BAD)
   05225 Hepatocellular carcinoma
    100473937 (BAD)
   05221 Acute myeloid leukemia
    100473937 (BAD)
   05220 Chronic myeloid leukemia
    100473937 (BAD)
   05218 Melanoma
    100473937 (BAD)
   05211 Renal cell carcinoma
    100473937 (BAD)
   05215 Prostate cancer
    100473937 (BAD)
   05213 Endometrial cancer
    100473937 (BAD)
   05223 Non-small cell lung cancer
    100473937 (BAD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100473937 (BAD)
   05014 Amyotrophic lateral sclerosis
    100473937 (BAD)
   05020 Prion disease
    100473937 (BAD)
   05022 Pathways of neurodegeneration - multiple diseases
    100473937 (BAD)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100473937 (BAD)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100473937 (BAD)
   05161 Hepatitis B
    100473937 (BAD)
   05160 Hepatitis C
    100473937 (BAD)
   05162 Measles
    100473937 (BAD)
   05168 Herpes simplex virus 1 infection
    100473937 (BAD)
   05165 Human papillomavirus infection
    100473937 (BAD)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100473937 (BAD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100473937 (BAD)
   01524 Platinum drug resistance
    100473937 (BAD)
   01522 Endocrine resistance
    100473937 (BAD)
SSDB
Motif
Pfam: Bcl-2_BAD Bclx_interact
Other DBs
NCBI-GeneID: 100473937
NCBI-ProteinID: XP_002916713
Ensembl: ENSAMEG00000017990
UniProt: D2H4T7
LinkDB
Position
16
AA seq 168 aa
MFQIPEFEPSEQEDSSPADRGLGPSPTGDQPPGPGKHRQTAPGLLGEAAHPQGQPASSNH
HGGAGAVEPRSRHSSYPAGTEEDEGLEEEELSPFRGRSSSAPPNLCAALRYGRELRRMSD
EFQGSFKGLPRPKSAGTATQMRQSPSWTRVIQSWWDRNLGRGGSAPSQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgttccagatcccagagtttgagcccagtgagcaggaagactccagccctgcagatagg
ggcctgggccccagccccacaggggaccagcccccaggccctggcaagcaccggcagaca
gccccaggcctcctaggggaagctgctcacccccaggggcagccggccagcagcaaccac
catggaggcgctggggctgtggagccccggagtcgccacagctcgtaccccgcggggacc
gaagaggatgaagggttggaggaggaagagctcagccctttccgggggcgctcgagctca
gcgccccccaacctctgtgctgcactgcgctatggccgcgagctccggaggatgagcgac
gagttccagggctccttcaagggacttcctcgcccgaagagcgcgggcacagcgacgcag
atgcgacaaagccccagctggacgcgcgtcatccagtcctggtgggatcggaacttgggg
agaggaggctccgccccctcccaatga

DBGET integrated database retrieval system