KEGG   Ailuropoda melanoleuca (giant panda): 100473974Help
Entry
100473974         CDS       T01329                                 

Gene name
OGDHL
Definition
(RefSeq) oxoglutarate dehydrogenase-like
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00020  Citrate cycle (TCA cycle)
aml00310  Lysine degradation
aml00380  Tryptophan metabolism
aml01100  Metabolic pathways
aml01200  Carbon metabolism
Module
aml_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100473974 (OGDHL)
  09105 Amino acid metabolism
   00310 Lysine degradation
    100473974 (OGDHL)
   00380 Tryptophan metabolism
    100473974 (OGDHL)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     100473974 (OGDHL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 100473974
NCBI-ProteinID: XP_002926280
Ensembl: ENSAMEG00000007386
UniProt: D2HUG6
LinkDB All DBs
Position
Un
AA seq 1006 aa AA seqDB search
MSQLRLLPSRLGVQASRFLAPHDIQMFNWRSRSSGPPATFPSGKRGGSSSYMEEMYFAWL
ENPQSVHKYWDSFFRKASEEGACDPTQPRFPESRPAVSSRTETSKLVEDHLAVQSLIRAY
QIRGHHVAQLDPLGILDADLDSFVPSDLITTIDKLAFYDLREADLDKEFQLPTTTFIGGP
EHTLSLREIIRRLESTYCQHIGLEFMFINDVEQCQWIRQKFETPGVMQFSSEEKRTLLAR
LVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIENVILGMPHRGRLNV
LANVIRKDLEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRVTHRNITLSLVANPSHL
EAVDPVVQGKTKAEQFYRGDAQGKKVMSILVHGDAAFAGQGVVYETFHLSDLPSYTTNGT
VHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVIYVCSVAAEWRNTF
NKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHRQVPVLKKYADKLIAEGTVTLQEFEE
EIAKYDRICEEAYGRSKDKKILHIKHWLDSPWPGFFNVDGEPKSMTCTATGIPEDVLTHI
GEVASSVPVEDFKIHTGLSRILRGRADMTKTRTVDWALAEYMAFGSLLKEGIHVRLSGQD
VERGTFSHRHHVLHDQEVDRRTCVPMNHLWPDQAPYTVCNSSLSEYGVLGFELGYAMASP
NALVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNGIVLLLPHGMEGMGPEHSSARPER
FLQMSNDDSDAYPVFTEDFEVSQLYDCNWIVVNCSTPANYFHVLRRQVLLPFRKPLIIFT
PKSLLRHPEAKCSFDQMVSGTSFQRVIPEDGAAAQASEQVRRLIFCTGKVYYDLVKERSS
QGLEEQVAITRLEQISPFPFDLIKREAEKYPGAELVWCQEEHKNMGYYDYISPRFMTILS
RARPIWYVGRDPAAAPATGNRNTHLVSLKKFLDTAFNLQAFEGKTF
NT seq 3021 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagctgagactgttgccctcccggcttggggtgcaggcctcaaggttcctggcc
ccacatgacatccagatgttcaactggcgcagcaggtcatctgggccaccggccaccttc
ccaagcggcaaacgtggaggcagctccagttacatggaggagatgtacttcgcctggttg
gaaaacccccagagcgtgcacaagtactgggatagcttcttccgaaaagccagtgaggaa
ggcgcctgtgacccgactcagccacggttccctgagagcaggccagcagtctcgagtcgg
accgagaccagcaagcttgtagaggaccacctggctgtgcagtccctgatccgggcctac
cagatccggggccaccatgtggcccaactggaccccctgggcattctggatgcagacctg
gactcctttgtgccctcagacttaatcacaaccatcgataaattggccttctatgacctg
cgggaggctgacctagataaggaattccagctgcccacgaccaccttcatcggggggcct
gaacataccctgtctctgcgggagatcattcggcgcctggagagcacctactgccagcac
atcggcctggagttcatgttcatcaatgatgtggagcagtgccagtggatccggcagaag
ttcgagacgcccggcgtgatgcagttctccagtgaggagaagcggaccctcctggcccgg
ctggtgcgctccatgagatttgaagacttcctggcccggaagtggtcctccgagaagcga
tttggcctggagggctgtgaggtcatgattcccgccctcaagaccatcatcgacaagtcc
agtgagatggggatcgagaatgtcatcctcgggatgccacacaggggcaggctgaatgtg
ctggccaacgtgatccgcaaggacctggagcagatcttctgccagtttgaccccaagctg
gaggcggcagacgagggctctggagacgtcaaatatcacctcggcatgtaccatgagagg
atcaaccgggtcacccacagaaatatcactttgtccctcgtggccaacccttcccacctg
gaagccgtggaccctgtggtgcagggaaagacgaaggcagaacagttctaccgaggggat
gcccagggcaagaaggtcatgtccatcctggttcatggggatgctgccttcgctggccaa
ggtgtggtgtatgagaccttccacctgagtgacctgccctcttacaccaccaatggtact
gtgcatgtggttgtcaacaaccagattggcttcaccacagacccccgcatggcccgctcc
tcgccataccctaccgatgtggcccgtgtggtcaacgcgcctatcttccacgtgaatgca
gatgacccagaggccgtgatatacgtgtgcagtgtggcagccgagtggaggaacacgttc
aataaagatgttgtggtggacttggtctgttaccgccggcgtggccacaatgagatggac
gagcccatgttcacacagccgctcatgtacaagcagatccacagacaggtgcctgtgctg
aagaagtacgcagacaagctcattgctgagggcacagtcaccctgcaagagttcgaggaa
gaaatcgccaaatacgaccggatctgtgaggaggcatatggcaggtccaaggataaaaag
atcctgcacataaagcactggctggactccccctggcctggcttcttcaatgtggacggg
gagcccaagagcatgacgtgcacagccacaggcattcccgaggacgtcctgacccacatt
ggagaagtggccagctccgtgcctgtggaggacttcaagatccacaccggcctctctcga
atcctgcggggccgtgcggacatgaccaagacacggacggtggactgggcactggcagag
tacatggccttcggctccttgctcaaggagggcatccatgtgcggcttagcgggcaggat
gtggagaggggcacgttcagtcaccggcaccacgttctccatgaccaggaagttgaccgg
aggacgtgtgtccccatgaaccacctttggcctgaccaggccccctacactgtgtgcaac
agctccctctcagagtatggagtcctgggctttgagttgggctatgccatggccagcccc
aatgccctggtcctctgggaggctcagtttggtgacttccacaacacagcccagtgcatc
atcgaccagttcatcagcactggccaggccaagtgggtgcggcacaacggcatcgtattg
ctcctgccccacggcatggagggcatgggcccagagcactcctcagcaaggcccgagagg
ttcctgcagatgagcaatgacgactccgatgcctaccccgtgttcacggaggacttcgaa
gtgagccagctctatgactgcaactggatcgtcgtcaactgctccacaccagccaactat
ttccatgtgctgcgccgccaggtcctgctgcccttccgtaagccgctgatcatcttcaca
cccaaatctctgctgagacacccagaggccaagtgcagcttcgaccagatggtatctggg
acgagcttccagcgggtgattcctgaggatggggctgcggcacaggcttctgagcaggtc
cggcggctcatcttctgcaccggaaaggtgtactatgacctggtgaaggagcggagcagc
cagggcctggaggagcaagtggccatcacgcggctggaacagatctctccattccccttc
gacttgatcaagcgagaggcagagaagtacccaggcgcagagctggtgtggtgccaggaa
gagcacaagaacatgggctactatgactacatcagcccgcgcttcatgaccatcctgagc
cgggcacggcccatatggtacgttggccgtgacccagcagctgcaccagccacaggaaac
aggaacactcacttggtttctctgaagaagtttctggatactgcctttaatctccaggcc
tttgagggcaagacattttag

DBGET integrated database retrieval system