KEGG   Ailuropoda melanoleuca (giant panda): 100474086
Entry
100474086         CDS       T01329                                 

Gene name
IRF7
Definition
(RefSeq) LOW QUALITY PROTEIN: interferon regulatory factor 7
  KO
K09447  interferon regulatory factor 7
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04622  RIG-I-like receptor signaling pathway
aml04623  Cytosolic DNA-sensing pathway
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05164  Influenza A
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100474086 (IRF7)
   04621 NOD-like receptor signaling pathway
    100474086 (IRF7)
   04622 RIG-I-like receptor signaling pathway
    100474086 (IRF7)
   04623 Cytosolic DNA-sensing pathway
    100474086 (IRF7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100474086 (IRF7)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100474086 (IRF7)
   05160 Hepatitis C
    100474086 (IRF7)
   05164 Influenza A
    100474086 (IRF7)
   05162 Measles
    100474086 (IRF7)
   05168 Herpes simplex virus 1 infection
    100474086 (IRF7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100474086 (IRF7)
   05169 Epstein-Barr virus infection
    100474086 (IRF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100474086 (IRF7)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    100474086 (IRF7)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 100474086
NCBI-ProteinID: XP_034502489
Ensembl: ENSAMEG00000010613
LinkDB
Position
16
AA seq 495 aa
MAEAPERGPPRLLFGDWLLGEVSSGRYEGLRWLDAARTRFRVPWKHFARKDLGEADSRIF
KAWAVARGRWPPSSGGGGDQLALEGTLRASWKTNFRCALRSTQRFVMLQDNSGDPNDPHK
VYGLSSKLGWREGAGIHQGEEKALEDALPSMGGFPRPCLAGDAGESPGLGLEPEPCAPSP
LFGPAGNAGDLLLQALQQSCLEDHLLEAAWGAESAPPEAPGPELPDTEPSLPRAGELAPM
HQAQVTDAALEPCPPVAGEQILARPGRAPPAAQAEPSLRALDVTITYKGRTVLQETVWHP
SFVLLYGPPSPAATATASQHVAFPSPAELPDQKQLHYTEKLLQHVAPGLQLELRGHGLWA
RRLGKCKVYWEVGGPLGSASPSTPPRLLQRNQDTPIFDFGTFFREMMEFRARRRRGSPHY
TIYLGFGQDLSAGRPKEKSLVLVKLEPRLCRAHLECVQREGVSSLDSSSLGLCLSSSNSL
YEDLEHFLMEVEQPA
NT seq 1488 nt   +upstreamnt  +downstreamnt
atggccgaggctcctgagaggggccccccgcgcctgctgttcggagactggcttctgggg
gaggtcagcagcggccgatacgaaggcctgcggtggctggacgcagcccgcacgcggttc
cgcgtgccctggaagcacttcgcgcggaaggacctgggagaggcggattcacgcatcttc
aaggcttgggctgtcgcgcgcggcaggtggccgcccagcagcggcggcggcggtgaccag
ttggcccttgagggcacactccgcgccagctggaaaaccaacttccgctgtgcgctacgc
agcacgcagcgtttcgtgatgctgcaagacaactcgggggaccccaatgacccgcataaa
gtgtacgggctcagctccaagctggggtggagagaaggtgcgggcattcaccagggggag
gagaaggcccttgaagatgccctgccctcgatgggtgggttccctaggccatgcctggca
ggggacgctggtgagagcccagggctcgggctggaacctgagccctgtgccccaagcccc
ctctttggcccagctggcaacgctggggacctcttgctccaggctctacagcagagctgc
ctggaggaccatctgctggaagctgcatggggggcggagtcagcccccccagaggctcct
ggcccagagctcccggacacagagccgtccctgccaagggcaggagagctggcccccatg
caccaggcccaggtgacagatgcagccctggagccctgccccccagtggcaggggagcag
atcctggccaggcctggccgcgccccgccggcagcccaggcagagcccagcctcagggcc
ctggatgtgaccatcacgtacaagggccgcaccgtgctgcaggagacggtgtggcatccc
agcttcgtgctcctgtacgggcccccgagcccagccgccacggccacggcgtcccagcac
gtggccttcccgagcccggccgagctccctgaccagaagcagctgcactacaccgagaag
ctgctgcagcacgtggcccctggcctgcagctggagttgcgggggcacgggctgtgggcc
cggcgcctgggcaaatgcaaggtctactgggaggtgggcgggcccctgggctctgccagc
ccctccacacccccccgcctgctgcaaaggaaccaggacaccccgatcttcgacttcggc
accttcttccgagagatgatggagttccgggctcgccggcgtcggggctccccacactac
accatctacctgggctttgggcaggacctgtcagctgggaggcccaaggagaagagcctg
gtcctggtgaagctggagccacggctgtgccgggcgcacctggagtgcgtgcagcgagaa
ggggtgtcctccctggacagcagcagcctcggcctctgcctgtccagctccaacagcctc
tacgaagacctggagcacttcctcatggaggtggagcagccggcctga

DBGET integrated database retrieval system