KEGG   Ailuropoda melanoleuca (giant panda): 100474559
Entry
100474559         CDS       T01329                                 

Definition
(RefSeq) bcl-2-binding component 3, isoforms 1/2
  KO
K10132  Bcl-2-binding component 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01524  Platinum drug resistance
aml04115  p53 signaling pathway
aml04210  Apoptosis
aml04215  Apoptosis - multiple species
aml04390  Hippo signaling pathway
aml05016  Huntington disease
aml05162  Measles
aml05200  Pathways in cancer
aml05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100474559
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100474559
   04215 Apoptosis - multiple species
    100474559
   04115 p53 signaling pathway
    100474559
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100474559
  09162 Cancer: specific types
   05210 Colorectal cancer
    100474559
  09164 Neurodegenerative disease
   05016 Huntington disease
    100474559
  09172 Infectious disease: viral
   05162 Measles
    100474559
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100474559
SSDB
Motif
Pfam: PUMA Hepatitis_core Spore_YpjB
Other DBs
NCBI-GeneID: 100474559
NCBI-ProteinID: XP_034494466
LinkDB
Position
12
AA seq 149 aa
MRRGAERKPGGWKREKRAMANWSLGATSGPAGVVGADHAPPPPRLFPGPQPSLSPAEQHL
ESPVPSAPGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNALYERRRQEERQRHR
PSPWRVLYNLIMGLLPLPRGRGAPEMEPN
NT seq 450 nt   +upstreamnt  +downstreamnt
atgaggcggggagcagaaaggaaaccgggaggctggaaaagggagaagcgggccatggct
aattggtcccttggggccacctcagggcctgcaggggtggtgggtgctgaccacgcgccc
cctcccccccggcttttcccaggtcctcagccctcactctcgccggcagagcagcacctg
gaatcgccggtgcccagtgccccgggggccctggcgggaggccccacccaggcagccccg
ggagtccggggggaggaggagcagtgggcccgggagatcggggcccagctgcggcggatg
gcggacgacctcaacgcgctgtacgagcggcggagacaagaggagcggcagcgacaccgc
ccctcaccctggagggtcctgtacaatctcatcatgggactcctgccattacccaggggc
cgcggagccccggagatggagcccaattag

DBGET integrated database retrieval system