KEGG   Ailuropoda melanoleuca (giant panda): 100474723
Entry
100474723         CDS       T01329                                 

Gene name
PPARA
Definition
(RefSeq) peroxisome proliferator-activated receptor alpha isoform X2
  KO
K07294  peroxisome proliferator-activated receptor alpha
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml03320  PPAR signaling pathway
aml04024  cAMP signaling pathway
aml04920  Adipocytokine signaling pathway
aml04922  Glucagon signaling pathway
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    100474723 (PPARA)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100474723 (PPARA)
   04920 Adipocytokine signaling pathway
    100474723 (PPARA)
   03320 PPAR signaling pathway
    100474723 (PPARA)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100474723 (PPARA)
   04931 Insulin resistance
    100474723 (PPARA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100474723 (PPARA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100474723 (PPARA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:aml03310]
    100474723 (PPARA)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    100474723 (PPARA)
Nuclear receptors [BR:aml03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   100474723 (PPARA)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 100474723
NCBI-ProteinID: XP_011227718
Ensembl: ENSAMEG00000003383
LinkDB
Position
15
AA seq 440 aa
MVDTESPICPLSPLEADDLESPLSEEFLQEMGSIQEISQSIDTLSPASSPSSVTYPVAPS
SADEPASVALNIECRICGDRASGYHYGVHACEGCKGFFRRTVRLKLAYDRCDRHCKIQKK
NRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSEKAKLKAEILTCEHEPEDAETADLKSLAK
RIYEAYLKNFNMNKVKARVILAGKASNNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEA
EVRIFHCCQCTSVETVTELTEFAKSIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKD
GMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDLSLFVAAIICCGDR
PGLLNVGHIEKMQEGIVHVLKLHLQTNHPDNIFLFPKLLQKMADLRQLVTEHAQLVQVIK
KTESDAALHPLLQEIYRDMY
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggtagacacagaaagcccaatttgccccctctccccgctcgaggctgatgatctggaa
agcccattatctgaagaatttctacaagaaatgggaagcatccaagagatttctcaatcc
attgacaccctgtcccccgcttcgagcccctcgtcggtcacttacccggtggctcccagc
agtgctgacgaaccggccagcgtagccctgaacatcgagtgtcgaatctgtggcgacaga
gcctcaggctaccattacggagttcacgcgtgtgagggctgtaagggtttcttccggcga
accgtccggctgaagctggcctacgacaggtgtgaccgccactgcaagatccagaagaag
aaccggaacaagtgccagtactgtcgtttccacaagtgcctgtcggtcgggatgtcccat
aacgcaattcgctttggacgaatgccaagatcggaaaaagcgaaactgaaagcagagatt
ctcacctgtgaacatgagccggaagatgcagaaacggccgatctgaagtccctcgccaag
agaatctacgaggcctacctcaagaacttcaacatgaacaaggtcaaggcccgggtcatc
ctcgcggggaaggccagcaacaacccgccctttgtcatacacgacatggagacgttgtgt
atggccgagaagactctggtggccaagttggtggccaacggcatccagaacaaggaggcg
gaagtccgcatcttccactgctgccagtgcacgtccgtggagaccgtcaccgagctcacc
gagttcgccaagtccatccctggcttcgccaacttggacttgaatgatcaggtcactttg
ctgaaatacggagtttatgaggccatatttgccatgctgtcttctgtgatgaataaagac
gggatgctggtagcatatggaaatggttttataactcgtgaattcctaaagagcctaagg
aaaccgttttgtgatatcatggaacctaagtttgattttgccatgaagttcaacgcacta
gagctggatgacagcgacctctcccttttcgtggctgctataatttgctgtggagatcgt
cctggccttctaaacgtgggacacattgaaaaaatgcaagagggcattgtgcacgtgctc
aaacttcacttgcagaccaaccacccagacaacatctttctcttcccaaaactcctgcaa
aaaatggcggacctccggcagctcgtcacggagcacgcgcagctcgtgcaggtcatcaag
aagacggagtccgacgctgccctgcacccgctgctgcaggaaatctacagggacatgtac
tga

DBGET integrated database retrieval system