KEGG   Ailuropoda melanoleuca (giant panda): 100475314
Entry
100475314         CDS       T01329                                 

Gene name
BIRC5
Definition
(RefSeq) baculoviral IAP repeat-containing protein 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01524  Platinum drug resistance
aml04210  Apoptosis
aml04215  Apoptosis - multiple species
aml04390  Hippo signaling pathway
aml05161  Hepatitis B
aml05200  Pathways in cancer
aml05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    100475314 (BIRC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100475314 (BIRC5)
   04215 Apoptosis - multiple species
    100475314 (BIRC5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100475314 (BIRC5)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100475314 (BIRC5)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100475314 (BIRC5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100475314 (BIRC5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aml01002]
    100475314 (BIRC5)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aml03036]
    100475314 (BIRC5)
Peptidases and inhibitors [BR:aml01002]
 Peptidase inhibitors
  Family I32: IAP family
   100475314 (BIRC5)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     100475314 (BIRC5)
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100475314 (BIRC5)
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 100475314
NCBI-ProteinID: XP_002918421
Ensembl: ENSAMEG00000013864
UniProt: G1M5J0
LinkDB
Position
13
AA seq 142 aa
MGASSLPPAWQFYLKDHRVSTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLSEFLKLDKERAKNKIAKETNSK
QKEFEETAKRVRGAIEQLAAVE
NT seq 429 nt   +upstreamnt  +downstreamnt
atgggcgcttcgtcgttgccccccgcctggcagttctacctcaaggaccaccgcgtctct
acgttcaagaactggccgttcttggagggctgcgcttgcaccccggaacggatggcagag
gccggcttcatccactgtcccactgagaacgagcccgacttggcccagtgtttcttctgc
ttcaaggagctggaaggctgggagccagatgatgaccctatagaggagcataaaaagcat
tcatctggttgtgcttttctttctgtcaagaagcagtttgaagagttaaccctcagtgaa
tttttgaaactggacaaagaaagagccaagaacaaaatcgcaaaggaaaccaacagtaag
cagaaagaatttgaagagaccgcaaagagagtgcgcggtgccatcgagcagctggccgcc
gtggagtaa

DBGET integrated database retrieval system