KEGG   Ailuropoda melanoleuca (giant panda): 100475480
Entry
100475480         CDS       T01329                                 

Gene name
IRF9
Definition
(RefSeq) interferon regulatory factor 9
  KO
K04693  interferon regulatory factor 9
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04217  Necroptosis
aml04380  Osteoclast differentiation
aml04621  NOD-like receptor signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04630  JAK-STAT signaling pathway
aml05160  Hepatitis C
aml05162  Measles
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05171  Coronavirus disease - COVID-19
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100475480 (IRF9)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100475480 (IRF9)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100475480 (IRF9)
   04625 C-type lectin receptor signaling pathway
    100475480 (IRF9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100475480 (IRF9)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100475480 (IRF9)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100475480 (IRF9)
   05171 Coronavirus disease - COVID-19
    100475480 (IRF9)
   05164 Influenza A
    100475480 (IRF9)
   05162 Measles
    100475480 (IRF9)
   05168 Herpes simplex virus 1 infection
    100475480 (IRF9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100475480 (IRF9)
   05169 Epstein-Barr virus infection
    100475480 (IRF9)
   05165 Human papillomavirus infection
    100475480 (IRF9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100475480 (IRF9)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    100475480 (IRF9)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 100475480
NCBI-ProteinID: XP_034504272
Ensembl: ENSAMEG00000016347
LinkDB
Position
20
AA seq 431 aa
MFPPTASVPLMLPATLVPRMASGRARCTRKLRNWVVEQVESGQFPGVCWDDAAKTMFRIP
WKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTEGPAIWKTRLRCALNKSPEFEEVPENG
HRDGAEPYKVYRLLPPSGTLPAQSGTQKSPSKRRHSSVSSEKEEDEGNTKNCVLSPSLFE
DPLRNEEVGANGATGLSNFGSSSGSNSPEPQEDTSTAEAPFQGDQVSLEFLPPPDSDYSL
LLTFIYGGRVVGEAQVQSLDCRLVAEPSGTRCGMEQVVFPKPDPREPTQRLLSQIERGVL
VASNSRGVFVQRLCPIPVSWNAPQAPPGPGPHLLPSNECVELFRTTYFCRDLARYFQGLG
PPPKFQVTLNFWEESPSPNHTPKSLITVQMEQAFARHLLEETPEEQAAAVSLLQSLGDPP
SASPLSSSYLL
NT seq 1296 nt   +upstreamnt  +downstreamnt
atgttccctcccacggcgtcagttccactgatgctgcctgcgactcttgtccccaggatg
gcatcaggcagggcacgctgcacccgaaaactgcggaactgggtggtggagcaagtggag
agcgggcagttccccggggtgtgctgggacgatgcagccaagaccatgttccggatcccc
tggaagcacgcgggcaagcaggacttccgggaggaccaggatgctgccttcttcaaggcg
tgggcgatatttaaggggaagtacaaggaaggggacacggaaggccctgctatctggaag
actcgtctacgctgtgccctcaacaagagtcctgaatttgaggaggttcctgagaacggc
catagggacggagctgagccctacaaggtgtatcggctgctgccgccatcagggaccctc
cctgctcagtcggggactcagaaatcaccatcaaagcgacgtcacagttctgtgtcctct
gagaaggaggaagatgagggtaacacaaagaactgcgtgctcagtccctccttgtttgag
gaccccctcagaaatgaggaggtgggggccaatggggcaacaggcctttcaaactttggg
agcagcagcggcagcaacagccctgagcctcaggaagatacaagcacagctgaagcccct
ttccaaggagatcaggtgtcattggagtttctgccccctccagactcagactactcgctg
ctgctcaccttcatctacggcgggcgcgtggtgggtgaggcccaggtgcagagcctggac
tgccgcctcgtggccgagccctcgggcacccggtgcggaatggagcaggtggtctttccc
aagcctgacccccgagagcccacccagcgcctgctgagccagatcgagaggggcgtcctg
gtagccagcaactcccggggcgtcttcgtgcagcgcctctgccccatccccgtctcctgg
aacgcgccccaggcaccacctggcccggggccgcatctgctgcccagcaatgagtgcgtg
gagctcttcagaaccacctacttctgcagagacttggccaggtacttccagggtctgggc
cccccacccaagttccaggtgacactgaatttctgggaggaaagccccagccccaatcat
accccaaagagtcttatcacagtgcagatggagcaggccttcgcccggcatctactggag
gagactccagaggagcaggcagccgctgtgtccctgctgcagagcctgggggacccacct
tccgcctctcctctctcttcctcctatctcctttga

DBGET integrated database retrieval system