KEGG   Ailuropoda melanoleuca (giant panda): 100475507
Entry
100475507         CDS       T01329                                 

Gene name
CCNB2
Definition
(RefSeq) G2/mitotic-specific cyclin-B2 isoform X1
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04068  FoxO signaling pathway
aml04110  Cell cycle
aml04114  Oocyte meiosis
aml04115  p53 signaling pathway
aml04218  Cellular senescence
aml04914  Progesterone-mediated oocyte maturation
aml05166  Human T-cell leukemia virus 1 infection
aml05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100475507 (CCNB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100475507 (CCNB2)
   04114 Oocyte meiosis
    100475507 (CCNB2)
   04115 p53 signaling pathway
    100475507 (CCNB2)
   04218 Cellular senescence
    100475507 (CCNB2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100475507 (CCNB2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100475507 (CCNB2)
   05170 Human immunodeficiency virus 1 infection
    100475507 (CCNB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aml03032]
    100475507 (CCNB2)
   03036 Chromosome and associated proteins [BR:aml03036]
    100475507 (CCNB2)
DNA replication proteins [BR:aml03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100475507 (CCNB2)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100475507 (CCNB2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C DUF5806
Other DBs
NCBI-GeneID: 100475507
NCBI-ProteinID: XP_002926596
Ensembl: ENSAMEG00000004603
UniProt: G1LDA3
LinkDB
Position
5
AA seq 397 aa
MALLRRPMVSTDLENADTGVNSKAKSHVTIRRAVLEEIGNRVTTRATQVAKKAQNTKIPA
QPTKTNVNKQLKPTASVKPVQMEVLAPKGPSPPSEDISMKEEKLCQAFSDALLCKIEDID
HEDWENPQLCSDYVKDIYQYLRQLEILQSISPHFLNGREINGRMRAILVDWLVQVHSKFR
LLQETLYMCVAIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAY
TSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLIDYDMV
HYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENEVLEVMQHMAKNVVKVNENLTKF
IAIKNKYASSKLLQISTLPQLNSKTIRELASPLMGRS
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggcgctgctccgacgcccgatggtgtccactgatttggagaatgctgacactggagtt
aattctaaagctaagagtcatgtgacaatcagacgggcagttttggaagaaattggaaat
agagttacaaccagagctacacaagtagctaagaaagctcagaacaccaaaatacctgct
caacccaccaaaacaaatgtcaacaaacaactgaaacctactgcatctgtgaaaccagtg
cagatggaagtgttggctccaaagggtccttcccccccatcagaggatatctccatgaag
gaagagaaactctgccaagctttctctgatgccttgctctgcaaaatcgaggacattgat
cacgaggactgggagaaccctcagctctgcagcgactacgttaaggatatctaccagtat
ctaaggcagcttgagattctgcaatccataagtccgcacttcttaaatggaagagagata
aacggacgcatgcgcgccatcctggtggactggctggtgcaagtccactccaagtttagg
ctgctgcaggagactctgtacatgtgcgtcgccatcatggaccggtttctgcaggttcag
ccggtttctcgtaagaagcttcagctggttgggattacagctctgctcctggcttccaag
tacgaggagatgttttctccaaatattgaagacttcgtttacatcacagacaatgcttat
accagttcccaaatccgagagatggaaacactgattttgaaagaactgaaatttgagttg
ggtcgacctttgccactacatttcttaaggcgggcatcaaaagccggggaggtcgatgtg
gaacagcacactttagccaaatacctgatggagttgactctcattgactacgatatggtg
cattatcacccttcaaaggtggcagcggctgcgtcctgcctgtcccagaaggttctgggc
caaggaaaatggaacttaaagcagcagtattacactggatacacagagaatgaagtattg
gaagtcatgcagcacatggccaaaaatgtagtgaaagttaatgaaaacttaacgaaattc
atcgccatcaagaataagtacgcaagcagcaaactcctgcagatcagcacacttcctcag
ctgaactcaaaaaccatccgagagcttgcctcccctctgatgggacggtcctag

KEGG   Ailuropoda melanoleuca (giant panda): 100476957
Entry
100476957         CDS       T01329                                 

Gene name
CCNB3
Definition
(RefSeq) G2/mitotic-specific cyclin-B3 isoform X2
  KO
K21771  G2/mitotic-specific cyclin-B3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04068  FoxO signaling pathway
aml04110  Cell cycle
aml04218  Cellular senescence
aml04914  Progesterone-mediated oocyte maturation
aml05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100476957 (CCNB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100476957 (CCNB3)
   04218 Cellular senescence
    100476957 (CCNB3)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100476957 (CCNB3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100476957 (CCNB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aml03032]
    100476957 (CCNB3)
   03036 Chromosome and associated proteins [BR:aml03036]
    100476957 (CCNB3)
DNA replication proteins [BR:aml03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100476957 (CCNB3)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100476957 (CCNB3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100476957
NCBI-ProteinID: XP_019653621
LinkDB
Position
X
AA seq 1355 aa
MPLPLPSRTSKPETKKSQSSKIVPSDHGQSEKEGENYQAKISSSSPKRQSKKRSAFEDLT
NASQTQPAQLKKEANKELVKDVSKKIKGSTSALGLAKTNEMNMESYKLEPSPVVVSTTLV
PNIMEKPHILEISTISKTTTTEEVSFFKKPLILKEELTTEDTSLFKRSLSLKKSTNQGEV
SLMEKPPSLQEEADSNDEFVVEPMTFGKKHKTEKAAITKGTLSLKKMCTYQGDLALQDIT
VEEDSFLMEPTNFSKKPKTEEAAPTKKVLSLKKKKYTTQGKVSHVKKPLGLQKTTSEEES
LIKEPLAFKKKPTSKEATFTLRPLSLKKKCTTKGKLADLKKPLELQKATSGEKALIKEPL
SFKKKPTSKEESLFQEPSALQEKHTTVGEVVLLKKPQALQEENDSKDKFLMEPMSLRKKR
TTKETDPTKKPLPVKKKSTIQGKMYHLKMPLVLHKTTSGEKSFVKEPWSSKKDTTEESLF
HEPSMLQEKHTTQEEVSILKAFTFQKTLTEKESLLKEPLAFKKKRTIEEATPTKKLLSLK
KKKCTSQGEVSCLQKPLELQATAGEKSLIEEALSFENKSTTEEESLFKESPVLQEKHTTQ
GEVALLKNPRALQENVDGEDEFLIEPVPFRKEDTTDEAVSTKEPLSLKKKKCSIQIMMSI
CQELLDLQNMISKDKDSFLMEPGSLRKKCSTEEVVLTKTPLSLKKKQITQKKMFLLKNPL
VSEKTTPEEESFFKNLLPLNKKSVTEGDILFQDPSVLKEKHTTLQEMSLSTKSLALPEKT
TTEEESYRKEPLTLEEKPTTEEEFLPQEPFSLHVKPTNKDEFLFWKALGLQKKTDTKEES
LKKLLALQEKSTTEEESLLNKPLVLKEELSTEVATSIEKQLSLKKKPTAQGEVFVLKKHL
ALQENITNEESFIKQPLAFQKTSIEETIPRESLALQENPTVEEEATLSGPLALQEKPSSE
KETLFQEPLSPQEKPTLNEMFPVKETFALNEKPTTGKELSLKEPLALQENPTQKEHKSLK
DFFILQVENSSHVSSTAPKSRIGMSSVGEFNTTSESSVCESSSDKPSSSWGKRSQKEIIP
LEDIDKNHSDPFFNPIYAKDIFSYMKEREEKFILKKYMNRQTDISSCMRAILVDWLVEVQ
MTFEMSHDTLYLAVKLVDHYLMEVVCKRDKLQLLGCTAFLIAAKFEEPCPPCVDDFLYIC
DDIYQRDEMLTMEISILQTLKFDINIPIAYHFLRRYAMCLCASMKTLTLSRFICEMTLQE
YDYVQERASKLAAGSFLLALYMKKLGHWAPALEYYSGYKTSDLHPLVKQLNTLLTLRPCN
KLKTVHSKYSHQVFFEVTEIPPLDVLKIEEILNYG
NT seq 4068 nt   +upstreamnt  +downstreamnt
atgccactgccactaccgtcccgaacctccaaacctgagactaagaaatcgcagtctagc
aaaattgtgcccagtgatcatggccaatctgaaaaggagggggagaattaccaagcaaag
atctcttcatcttcacctaagagacaaagcaaaaagagatcagcttttgaagatctcacc
aatgcttctcaaactcaacctgcccagctcaagaaagaagccaataaggagcttgttaaa
gatgtttccaagaagataaaagggagcacatctgctcttggattggccaaaaccaatgag
atgaatatggaaagttataagctggaaccctccccagtagtagtctctactaccttggta
ccaaatattatggagaaaccacacattctggagatatctaccatctctaaaacaaccact
actgaggaggtatcatttttcaaaaaaccattaattttaaaagaggaactcactactgag
gacacaagccttttcaagaggtcattatctttaaagaagtccacaaatcagggggaggta
tccctcatggagaagccaccatccttacaggaggaggctgacagcaatgatgagtttgtt
gtagagccaatgacttttgggaagaagcataaaactgagaaggcagccatcaccaaagga
acattatccttaaagaagatgtgcacatatcagggggacttggctttgcaggacatcact
gttgaagaggattccttcttaatggagccaacaaactttagcaagaagcctaaaacagag
gaggcagcccccaccaagaaagtgttatctttaaagaagaagaagtataccactcaggga
aaggtgtcccatgtgaagaaaccactaggattgcagaagaccacctctgaagaggagtcc
ctcattaaggagccactggctttcaagaagaaacctactagcaaggaggcaaccttcacc
ttgaggccattatctttaaagaagaagtgtactactaaagggaagctagctgacttgaaa
aagccattagaattgcagaaggccacctctggagagaaggcactcattaaggagccattg
tcttttaaaaagaagcctacctctaaggaggagtctctcttccaggagccatctgcattg
caagagaagcacaccactgttggggaggtggtcctcttgaagaagccacaggcattgcag
gaggagaatgatagtaaggataaatttcttatggagccaatgtcccttaggaagaaacgt
actaccaaggagacagaccccaccaagaagccattacctgtaaagaagaagagtaccatt
caggggaagatgtaccacttgaagatgccactagtattgcataagaccacctctggagag
aagtcattcgttaaggagccatggtcctctaagaaggacaccactgaggagtcccttttc
catgagccatccatgttgcaagagaagcacaccactcaggaggaggtgtccatcttgaag
gccttcacctttcaaaagactctaactgagaaggagtcacttttaaaggaacctttggct
tttaagaagaaacgtaccattgaggaggcaacccccaccaagaagctattatctttaaag
aagaaaaagtgtactagtcagggtgaggtgtcctgcttgcagaagccactagaattgcag
gccaccgctggagagaagtcactcattgaggaggcattgtcctttgaaaataagtctacc
actgaggaggaatctctcttcaaggaatcacctgtgttgcaagagaagcataccacacag
ggggaagtggctcttttgaagaatccacgggcgttgcaggagaatgtcgatggtgaagat
gaatttcttatagaaccagttccctttaggaaggaggataccacagatgaggcagtctct
accaaggagcctttatctttaaagaagaaaaagtgttccattcaaataatgatgtccatc
tgccaagaactgttggacttgcagaatatgattagtaaagataaggattccttccttatg
gagccagggtcacttaggaagaagtgttcaactgaggaggtagtccttaccaagacaccg
ttatctttaaagaaaaagcaaatcactcagaagaagatgttcctcttaaagaatccactg
gtctcagagaagaccacccctgaagaagagtcattctttaagaatttattgcccttaaat
aaaaagtctgtaactgaaggggatatcctcttccaggatccatctgtactgaaagagaag
cacaccactctgcaggagatgtccctctcaactaagtcattggccttgccagaaaagacc
accactgaagaagaatcatatcgtaaggaaccattgaccttagaggagaagcctactact
gaggaggaattccttcctcaggagccattttcattgcatgttaaacctaccaacaaagat
gagttcctcttctggaaggctttgggcttgcagaagaagactgataccaaagaggagtcc
ttgaagaagctgttggctttgcaggagaaaagcactactgaagaggaatcccttttaaat
aaaccattggttctgaaggaggagctctccactgaggtggcaacaagcattgagaagcaa
ttatctttaaagaagaaacccactgctcagggggaggtatttgtcttgaagaagcatttg
gccttgcaagagaatatcaccaatgaagagtcttttattaagcaaccattggcttttcag
aagaccagcattgaggagaccatcccaagggagtccttggccttgcaggagaatcccaca
gttgaggaagaagctaccctgagtgggcccttggccttgcaggagaagcccagcagtgag
aaggagaccctcttccaggagccattgtcccctcaggagaaacctaccctcaatgagatg
ttccctgtcaaagagacatttgccttgaatgagaaacccaccactgggaaggagttgtcc
ctgaaggagccattggccttgcaagagaatcccacccaaaaggaacataagtctctcaaa
gatttcttcatcctccaagttgaaaacagctcacatgtgtccagcactgcccccaaatcc
agaataggcatgtccagtgtgggcgagttcaataccacaagcgagtccagtgtttgtgaa
tccagttccgataaaccttcctcatcttggggcaagaggtcacagaaggagataatccca
ttggaggatattgacaagaaccacagtgatccatttttcaacccaatatatgccaaggat
atcttcagttacatgaaggagagagaggaaaagttcatacttaaaaaatacatgaacagg
cagactgacatcagcagttgcatgagggccattcttgtggactggttggtagaggtgcag
atgacctttgagatgagtcacgataccctgtacttggcagtgaaactggtggatcactac
cttatggaggtagtatgcaagagggacaagctacaactccttggttgcactgcgtttctg
attgcagcaaaatttgaggagccctgcccaccttgtgtggatgacttcctatacatctgt
gatgatatttatcagcgagatgagatgctcaccatggaaatcagcatcttgcaaactctc
aaatttgatatcaacattcccatcgcctatcatttcctgcgcagatatgctatgtgtctc
tgtgccagcatgaagacactgactttgtcccgcttcatctgtgagatgactctgcaggaa
tacgactatgtccaggagagggcttccaagctagctgccggctccttcctcctggccctg
tatatgaagaagctcggacattgggctcctgctctggagtattacagtggctacaagacc
tctgatcttcaccccctggtcaagcagctgaacaccctgctgacattgcgtccttgcaac
aagctcaagactgtgcattccaagtattctcaccaggtcttctttgaagtcactgaaatc
ccccccttggatgtgttgaagatagaggagattttgaactacggctaa

KEGG   Ailuropoda melanoleuca (giant panda): 100484338
Entry
100484338         CDS       T01329                                 

Gene name
CCNB1
Definition
(RefSeq) G2/mitotic-specific cyclin-B1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04068  FoxO signaling pathway
aml04110  Cell cycle
aml04114  Oocyte meiosis
aml04115  p53 signaling pathway
aml04218  Cellular senescence
aml04914  Progesterone-mediated oocyte maturation
aml05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100484338 (CCNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100484338 (CCNB1)
   04114 Oocyte meiosis
    100484338 (CCNB1)
   04115 p53 signaling pathway
    100484338 (CCNB1)
   04218 Cellular senescence
    100484338 (CCNB1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100484338 (CCNB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100484338 (CCNB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aml03032]
    100484338 (CCNB1)
   03036 Chromosome and associated proteins [BR:aml03036]
    100484338 (CCNB1)
DNA replication proteins [BR:aml03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100484338 (CCNB1)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100484338 (CCNB1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Trypan_PARP DOCK_N
Other DBs
NCBI-GeneID: 100484338
NCBI-ProteinID: XP_002915930
Ensembl: ENSAMEG00000003117
UniProt: G1L8U3
LinkDB
Position
3
AA seq 425 aa
MALRVTRNTKVNVENKAKISMAGAKRVPLATAAASKPGLRPRTALGDIGNKVSEQPQAKL
PQKKEAKPLVPGKVIAKKIPKPLEKAPEPVPEPEPEPEPEPVKEEKLSPEPILVDTPSPS
PMETSGCAPSEEYLCQAFSDVILAVNDVDAEDGADPNLCSEYVKDIYAYLRQLEEEQAVR
PKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVG
VTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRSLNFGLGRPLPLHFLRR
ASKIGEVDVEQHTLAKYLMELTMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHY
LSYTEESLLNVMQHLAKNIVMVNRGLTKHMTIKNKYATSKHAKISTLAQLNSALVQDLAK
AVAKV
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggcgctccgagtcaccaggaacacaaaagtcaatgttgagaataaggcgaagatcagt
atggcaggcgcgaagcgcgtgcctctggccactgctgcggcctccaagcccggactgagg
ccaagaacagctctcggggacattggtaacaaagtcagcgaacaaccacaggccaaactg
cctcagaaaaaggaagcaaaacctttggttcctggaaaagttattgccaaaaaaatacct
aaacctctggaaaaggcacccgagcctgtgcctgagccagaaccagagccagaacctgag
cccgtgaaagaagaaaaactttcgcctgagcctattttggttgatactccctctccaagc
ccaatggaaacatctggatgtgccccttcagaagaatatctgtgtcaggcattctctgat
gtaattcttgcagtgaatgatgtggatgcagaagatggagctgatccaaacctttgtagt
gaatatgtgaaagatatttatgcttatctgagacaacttgaggaagagcaagcagtcaga
ccaaaatacctactgggtcgtgaagtcactggaaacatgagagccatccttattgactgg
ctagtacaggttcaaatgaaattcaggttactgcaggagaccatgtacatgactgtttcc
attattgatcggttcatgcagaataactgtgtgcccaagaagatgctgcagctggttggt
gtcactgccatgtttattgcaagcaaatatgaagaaatgtaccctccagaaattggtgac
tttgcctttgtgactgacaacacttacactaagcaccaaatcagacagatggaaatgaag
attctaagatctttaaattttggtctgggccgccctctacccctgcatttccttcggaga
gcatctaagattggagaggttgatgtggagcaacatactttggccaaatacctgatggaa
ctgactatgttggactatgatatggtgcactttcctccttctcagattgcagcaggagct
ttttgcttagcactgaaaattctcgataacggtgaatggacaccaactctacagcattat
ctctcatacactgaagaatcccttctaaatgttatgcaacacctggctaagaatatagtc
atggtgaatcgtgggcttacaaaacacatgactatcaagaacaaatatgccacatctaag
catgctaagatcagcactctggcacagctaaattctgcactagttcaagatttagccaag
gctgtggcaaaggtgtga

DBGET integrated database retrieval system