KEGG   Ailuropoda melanoleuca (giant panda): 100475573
Entry
100475573         CDS       T01329                                 

Gene name
CDH1
Definition
(RefSeq) cadherin-1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04015  Rap1 signaling pathway
aml04371  Apelin signaling pathway
aml04390  Hippo signaling pathway
aml04514  Cell adhesion molecules
aml04520  Adherens junction
aml05100  Bacterial invasion of epithelial cells
aml05200  Pathways in cancer
aml05213  Endometrial cancer
aml05216  Thyroid cancer
aml05218  Melanoma
aml05219  Bladder cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100475573 (CDH1)
   04390 Hippo signaling pathway
    100475573 (CDH1)
   04371 Apelin signaling pathway
    100475573 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100475573 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100475573 (CDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100475573 (CDH1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100475573 (CDH1)
   05216 Thyroid cancer
    100475573 (CDH1)
   05218 Melanoma
    100475573 (CDH1)
   05219 Bladder cancer
    100475573 (CDH1)
   05213 Endometrial cancer
    100475573 (CDH1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100475573 (CDH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aml03036]
    100475573 (CDH1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:aml04515]
    100475573 (CDH1)
   04090 CD molecules [BR:aml04090]
    100475573 (CDH1)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100475573 (CDH1)
Cell adhesion molecules [BR:aml04515]
 Cadherins
  Major cadherins
   100475573 (CDH1)
CD molecules [BR:aml04090]
 Proteins
  100475573 (CDH1)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro Cadherin_2 RET_CLD1 Big_9
Other DBs
NCBI-GeneID: 100475573
NCBI-ProteinID: XP_002923253
Ensembl: ENSAMEG00000007739
UniProt: G1LMI4
LinkDB
Position
12
AA seq 883 aa
MGPRYPSVSALLLLLQVSSWLCQEPEPCRPGFGADSYTFTVPRRHLERGRVLGRVSFEGC
TGQPRTAYIADDTRFKVSTDGVVTVKRPLQLHKPEMSFLVHAWDSSRRKLSTRVTLKAAE
HHHHHHHHHDVLSETQTEVLTFPNSQRGLRRQKRDWVIPPISCPENEKGPFPKNLVQIKS
NRDKEIKVFYSITGQGADTPPVGVFVIERETGWLKVTEPLDREQIAKYILYSHAVSSNGN
AVEDPMEIVITVTDQNDNKPEFTQEVFEGSVMEGALPGTSVMQVTATDADDDVNTYNAAI
AYRIVTQEPPLPSSMMFTINKDTGVISVLTTGLDRETIPKYTLVVEAADLQGEGLSTTAT
AVITVTDANDNPPVFKPTTYQGQVPENKADVEIAVLKVTDADVPNTPAWQAVYTILNNNN
EQFVVTTDPVTNDGILKTAKGLDYEAKQQYVLYVTVVNVAPFEVILSTSTATVTVDVEDV
NEAPVFKPCPKVVEIPEDFGVGQEITSYTAEDPDKYMEQRITYRIWRDAANWLEINPESG
AIFTRAELDREDIEHVKNSTYEAIIVAIDSGSPVATGTGTLLLILSDVNDNGPVPEPRNM
DFCQKNPQPRVININDPDLPPNTSPFTAELTHGASVNWTIEYNDQAHESLILKPKKTLEL
GDYKINLKLTDNQNKDQVTTLDVFVCDCEGVVNSCKRTAPYAEAGLQVPAILGILGGILA
LLILILLLLLFVRRRGVVKEPLLPPEDDTRDNVYYYDEEGGGEEDQDFDLSQLHRGLDAR
PEVTRNDVAPTLLSVPQYRPRPANPDEIGNFIDENLKAADTDPTAPPYDSLLVFDYEGSG
SEAASLSSLNSSESDQDQDYDYLNEWGNRFKKLADMYGGGEDD
NT seq 2652 nt   +upstreamnt  +downstreamnt
atgggccctcggtaccctagtgtctccgcgctcctgctgctgctacaggtctcatcatgg
ctatgccaggagccggagccctgccgtcctggctttggcgctgacagctacacgttcaca
gtgccccggcgacatttggagagaggccgagtcctgggcagagtgagttttgaaggatgc
actggtcaaccaaggacagcctatattgcggacgacacgcgattcaaagtgagcacagat
ggtgtggtgaccgttaagcggcctctacagcttcataaaccggagatgagttttctggtc
cacgcctgggactccagccgcaggaagctgtccaccagagtgacgctgaaggcagccgag
caccaccaccaccaccaccaccatcatgacgtgctctctgaaacccagacagaagtgctc
acatttcccaactcccagcgtggtctcagaagacagaagagagactgggttatccctcct
atcagctgcccagaaaatgagaagggcccatttcctaaaaacctggttcagatcaaatct
aacagggacaaagaaatcaaggttttctacagcatcactggccaaggagctgacacacct
cctgttggtgtgtttgttatcgaaagggaaacaggatggctgaaagtgacagagcctctg
gatagagaacaaattgccaagtacattctctactctcacgccgtgtcttctaatgggaat
gcagttgaagaccccatggagatcgtgatcacagtgacggatcagaatgacaacaagcct
gagttcacccaggaggtcttcgaaggatctgtcatggaaggtgctcttccaggcacctcc
gtgatgcaggtcacagccacagacgcggacgacgacgtgaacacctacaacgccgccatc
gcttaccgcatcgtcacccaagagccccccctgcctagcagcatgatgttcactatcaac
aaggacacgggagtcatcagcgtgctcaccaccgggctggaccgggagactattcccaag
tacaccctggtggttgaagctgcggacctgcaaggtgaaggcttaagtacaactgcaaca
gctgtgatcacggtcactgacgccaacgataacccccctgtcttcaaacctaccacgtac
caggggcaggtgcctgagaacaaggctgacgttgaaatcgccgtactcaaagtaactgat
gccgatgtccccaataccccagcgtggcaggccgtgtacaccatattgaataataacaat
gagcaatttgtcgtcaccacagacccagtaaccaacgacggcattttgaaaacagctaag
ggcttggattacgaggccaagcagcaatatgttctgtacgtgactgtggtgaatgtagcc
ccgtttgaggtcattctctccacctccacagccaccgtcactgtggacgtggaagatgtg
aacgaagcccctgtctttaagccttgcccgaaggttgtggaaatacctgaagactttggg
gtgggccaggaaatcacgtcctacactgccgaggatccggataagtatatggaacagagg
ataacgtatcggatttggagggatgctgccaattggctggagattaatccagaatctggt
gccattttcactcgggctgagctggacagagaggacatagagcatgtgaagaacagcacg
tacgaggccatcattgtagccattgacagcggttctccagttgctactggaacaggaacc
cttctcctcatactctctgatgtgaatgacaatggccccgtaccagaacctcgaaatatg
gacttctgccagaagaatccacagcctcgtgtcatcaacatcaatgatccagatcttccc
cccaacacatctcccttcacagcagaactaacacacggggcaagtgtcaactggaccatt
gagtacaatgaccaagcccatgaatctctaattttgaagccgaagaaaaccttagagttg
ggtgactacaaaataaatctcaagctcacggataatcagaacaaggaccaggtgaccacc
ctggatgtgttcgtgtgcgactgcgaaggggtcgtcaacagctgtaagaggacggcacct
tacgccgaagcaggcttgcaggttcctgccatcctgggcattctcggaggaatcctcgct
ttactaatcctgattctgctgcttctgctgtttgttcggaggagaggggtggtcaaagag
cccttactacccccagaagatgacacccgggacaacgtttactactatgatgaagaagga
ggtggagaagaggatcaggactttgacttgagccagttgcacaggggcctggatgctcgg
cccgaagtgactcgcaatgatgtggcgccaaccctcctgagtgtgccccagtatcggccc
cgccctgccaatcccgatgaaattggaaacttcattgacgaaaacctgaaggcagcggac
actgaccccaccgctcctccttacgactctctgctcgtgttcgactacgagggaagtggt
tccgaggctgctagtctgagctccttgaactcctcagagtcagaccaagaccaggactat
gactacctgaacgaatggggcaatcgcttcaagaagctggcggacatgtacggaggtggc
gaggacgactag

KEGG   Ailuropoda melanoleuca (giant panda): 105240970
Entry
105240970         CDS       T01329                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cadherin-1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04015  Rap1 signaling pathway
aml04371  Apelin signaling pathway
aml04390  Hippo signaling pathway
aml04514  Cell adhesion molecules
aml04520  Adherens junction
aml05100  Bacterial invasion of epithelial cells
aml05200  Pathways in cancer
aml05213  Endometrial cancer
aml05216  Thyroid cancer
aml05218  Melanoma
aml05219  Bladder cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    105240970
   04390 Hippo signaling pathway
    105240970
   04371 Apelin signaling pathway
    105240970
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    105240970
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    105240970
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105240970
  09162 Cancer: specific types
   05226 Gastric cancer
    105240970
   05216 Thyroid cancer
    105240970
   05218 Melanoma
    105240970
   05219 Bladder cancer
    105240970
   05213 Endometrial cancer
    105240970
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    105240970
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aml03036]
    105240970
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:aml04515]
    105240970
   04090 CD molecules [BR:aml04090]
    105240970
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    105240970
Cell adhesion molecules [BR:aml04515]
 Cadherins
  Major cadherins
   105240970
CD molecules [BR:aml04090]
 Proteins
  105240970
SSDB
Motif
Pfam: Cadherin Transthyretin Big_9
Other DBs
NCBI-GeneID: 105240970
NCBI-ProteinID: XP_034494139
LinkDB
Position
12
AA seq 510 aa
MSMRDKDPILTAMSEDSQKRKKRERQTRNQILHSREHTAGHQWGGRWGRGETGEEDEKST
CPDEPHLRNICDDHENTYNADIAYTILSQDPSVPQSNMFAINRDSGVISVLAPGLDQQST
PAYTLTVQAADLGGEGLRTTATVVITVTQSNPNPPIFSPTWYVGRVFENKVDAGIVRLKV
KDADVPGSPAWKAVFSILNDRAGLFTVTTDRETNDGLLKTAKLGGLDFETTQQYTLYVTV
ANAVPLASLPTSTATVTVDVMDVNEXPVFVPPIKMVEVPKDVGVGQEITSXRAQDPDSLQ
CQKIRYQIWHDPSHRLDINSETGVISTRASLHRDDMKNHTFSAVVIATDDGQPPATGSGT
LVLTLSDTDCPTVDSQCLSTCQRGPELPAGRGMESTSSPLTTHVLDTASGLPAQGLCLCL
SRLEDHGQQWMELRKSYTDSDGRCPGLLPPGPVKAGTYKLSFDTEGYWKKRGQESFYPYV
EVVFTITDETRRFHVPLLLSPWSYTTYRGS
NT seq 1533 nt   +upstreamnt  +downstreamnt
atgtcaatgagggacaaggatcccatactgacggccatgtcagaagattcccaaaagaga
aaaaagagggagaggcaaaccaggaaccagattcttcactctagagaacacactgctggt
caccagtggggagggaggtgggggaggggggaaacaggtgaggaggatgagaagagcacg
tgtcctgatgagccccatttgaggaacatctgtgatgatcacgagaacacctacaacgca
gacatcgcctacaccatcctcagtcaggacccctcggtacctcaatccaacatgttcgcc
atcaaccgggactcgggagtcatctctgtgctcgctcctgggctggaccaacagagcacc
cctgcgtacaccctgacggtccaagctgccgaccttggaggcgaaggcttacgcacgact
gcaacagttgtgatcacagtcacccagagcaaccccaaccctcccatcttcagccccacc
tggtacgtgggccgggtgtttgagaacaaggtggatgcagggatagtaaggctgaaggtg
aaggacgcagacgtccctggctcccccgcatggaaggctgtgttctccatcctgaatgac
agagcggggctcttcactgtcaccacggaccgcgagaccaatgacggccttctgaaaaca
gccaagttgggtggtttggattttgagaccacacagcaatacaccctctacgtgacagtg
gcgaatgcggtgcccttggcgtctctccccacgtccacagccaccgtcaccgtggatgta
atggacgtgaatgagnngcccgtcttcgtacccccgataaagatggtggaagtgcccaag
gatgttggtgtgggccaggaaataacatcatagagggcccaggacccagacagcctccag
tgtcagaaaatcaggtaccagatatggcacgacccaagccatcggctggacatcaactca
gaaacaggcgtcatttccactcgagccagtctgcacagggatgacatgaagaaccacaca
ttttcagcggttgtcatagctacagatgatgggcaaccacctgccacgggcagcgggacc
cttgtcctcactttgtctgacacagactgcccaacagtggactcacagtgcctttccacc
tgccagaggggaccagagctcccagctggcagaggcatggagtcgaccagcagcccactg
accacacacgtgctggacactgcctcggggcttccagcccagggcctctgcctctgtctg
tccaggctggaggaccacggccaacagtggatggagttgaggaaaagctacaccgactca
gacggccgctgcccagggctcctgccaccaggcccggtgaaggcaggcacctacaagctg
tcctttgacaccgagggctactggaagaagagggggcaggagagcttctacccatacgtg
gaggttgttttcaccatcaccgatgagacccgcaggttccacgtgcccctgctgctgagc
ccatggtcctacaccacgtatcgagggagctag

DBGET integrated database retrieval system