KEGG   Ailuropoda melanoleuca (giant panda): 100475582Help
Entry
100475582         CDS       T01329                                 

Definition
(RefSeq) apoptosis-associated speck-like protein containing a CARD
  KO
K12799  apoptosis-associated speck-like protein containing a CARD
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04217  Necroptosis
aml04621  NOD-like receptor signaling pathway
aml04623  Cytosolic DNA-sensing pathway
aml04625  C-type lectin receptor signaling pathway
aml05132  Salmonella infection
aml05133  Pertussis
aml05134  Legionellosis
aml05135  Yersinia infection
aml05164  Influenza A
Brite
KEGG Orthology (KO) [BR:aml00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100475582
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100475582
   04623 Cytosolic DNA-sensing pathway
    100475582
   04625 C-type lectin receptor signaling pathway
    100475582
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100475582
   05135 Yersinia infection
    100475582
   05133 Pertussis
    100475582
   05134 Legionellosis
    100475582
  09172 Infectious disease: viral
   05164 Influenza A
    100475582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD PYRIN
Motif
Other DBs
NCBI-GeneID: 100475582
NCBI-ProteinID: XP_002924797
Ensembl: ENSAMEG00000007176
UniProt: D2HQM1
LinkDB All DBs
Position
Un
AA seq 194 aa AA seqDB search
MGCTRDAILDALENLTADEFKKFKLKLLSVPLREGYGRIPRGTLMSMDAMDLTDKLVSFY
LEKYSAELTAVVLREIGMQETAEKLQEITCKGPAPGPAGIQDHQTAAKPGLHFVDQHRAA
LVARVTDVDGVLDALYGNVLSEEQYGAVRAEPTNPMKMRKLLGFAPAWNTTCKDLLLQAL
RNTHPYLVADLEKS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggggtgcactcgcgacgccatcctggatgccctggagaacctgactgcagacgagttc
aagaagttcaagctgaagctactttcagtgccactgcgcgaaggctatgggcgcatcccg
cgggggacactgatgtccatggacgccatggacctcacagacaagctcgtctctttctat
ctggaaaagtacagcgcagagctcactgcggtcgtgctgcgtgagattggcatgcaggag
acagcggagaagctgcaggaaatcacgtgcaaaggccccgctccagggcctgctgggatc
caggatcaccagactgcagccaagccaggactgcactttgtggaccagcaccgggcagcc
ctcgtcgcacgggtcacggatgtggatggggtgctagatgccctgtatgggaacgtcctg
tcggaggagcagtacggggcagtgcgggcagagcccaccaacccaatgaagatgaggaag
ctgctcggctttgctccagcctggaacacgacctgcaaagacctgctccttcaggccctg
aggaacacccacccctacctggtggccgacctggagaaaagctga

DBGET integrated database retrieval system