KEGG   Ailuropoda melanoleuca (giant panda): 100475779
Entry
100475779         CDS       T01329                                 

Gene name
E2F2
Definition
(RefSeq) transcription factor E2F2 isoform X1
  KO
K09389  transcription factor E2F2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01522  Endocrine resistance
aml04110  Cell cycle
aml04218  Cellular senescence
aml04934  Cushing syndrome
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05206  MicroRNAs in cancer
aml05212  Pancreatic cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05218  Melanoma
aml05219  Bladder cancer
aml05220  Chronic myeloid leukemia
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100475779 (E2F2)
   04218 Cellular senescence
    100475779 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100475779 (E2F2)
   05206 MicroRNAs in cancer
    100475779 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100475779 (E2F2)
   05225 Hepatocellular carcinoma
    100475779 (E2F2)
   05226 Gastric cancer
    100475779 (E2F2)
   05214 Glioma
    100475779 (E2F2)
   05220 Chronic myeloid leukemia
    100475779 (E2F2)
   05218 Melanoma
    100475779 (E2F2)
   05219 Bladder cancer
    100475779 (E2F2)
   05215 Prostate cancer
    100475779 (E2F2)
   05224 Breast cancer
    100475779 (E2F2)
   05222 Small cell lung cancer
    100475779 (E2F2)
   05223 Non-small cell lung cancer
    100475779 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100475779 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100475779 (E2F2)
   05161 Hepatitis B
    100475779 (E2F2)
   05160 Hepatitis C
    100475779 (E2F2)
   05163 Human cytomegalovirus infection
    100475779 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100475779 (E2F2)
   05169 Epstein-Barr virus infection
    100475779 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100475779 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100475779 (E2F2)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    100475779 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 100475779
NCBI-ProteinID: XP_002913315
Ensembl: ENSAMEG00000009662
UniProt: G1LSV7
LinkDB
Position
2
AA seq 440 aa
MLRGPRALAPAAGPPSKGLPAMSPTELWPPGLSSPQLCPATTTYYTSLYPQTVPPTAAPG
TCLDATPHGPEGQAVRCVPAGRLPAKRKLDLEGIGRPAVPEFRTPKGKCIRVDGLPSPRT
PKSPGEKTRYDTSLGLLTKKFIYLLSESKDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMSTEQALDQLIQSCSLTFKHLTE
DKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRSEENLQIYLKSTQGPIEV
YLCPEEVRDPDSPAQEPLPPSSPLGPSPDSTQPSSSTDPGMTEPTASPAPALTPQQVPQP
PAPPPPPLVPLEATDSMLELPHPLLQQTEDQFLSPSLPCSSPLISFSPPLDQDDYLWGLD
GGEGISDLFDSYDLGDLLIN
NT seq 1323 nt   +upstreamnt  +downstreamnt
atgctgcgagggccccgggccctggctccagctgccgggccgccctcgaagggactgccc
gcgatgagccctaccgagctgtggccacccggcctcagcagcccccagctctgcccggcc
accaccacctactacacctcgctgtacccgcagactgtgcctcccactgcggcgcccggc
acctgcctcgacgccaccccccacggaccggagggccaagctgtgcgatgcgtgccggct
ggccggctgccggccaaaaggaagctggacctggaggggatcgggaggcccgcagtccct
gaattccggactcccaaggggaagtgcattagagtggacggcctccccagccccagaacc
cccaagtcccccggagagaagactcggtatgacacttcgctggggctgctcaccaagaag
ttcatttacctcttgagcgaatccaaggatggggtcctggacctgaactgggccgccgag
gtgctggacgtgcagaaacgccgtatctatgacatcaccaacgtgctggagggtatccag
ctcatccgtaagaaggccaagaacaacatccagtgggtaggcaggggaatgtttgaagac
cccacccggcctgggaagcagcagcagctggggcaggagctgaaggagctgatgagcacg
gagcaggccttggaccagctcatccagagctgctctctgaccttcaagcacctgactgag
gacaaggccaacaagagactggcctatgtgacttaccaggacatccgtgccgttggcaac
tttaaggagcagacggtgatcgcggtcaaggcccctccccagacaagactggaggtgccc
gacaggagtgaggagaacctgcagatatatttgaagagcacgcaggggcccatcgaagtc
tacctgtgcccagaggaagtgcgggacccagacagccctgcccaggagcccctccccccc
tcctccccccttggccccagccctgactccacccagcccagcagcagcactgaccctggg
atgacagaacccacggcatccccagctccagcgctgactccccagcaggtcccgcagccg
cccgcgcccccgcccccaccgctggtccccctggaggccacggacagcatgctggaactg
ccgcacccacttctacagcagactgaggaccagttcctgtccccgagcctgccgtgcagc
tcacccctgatcagcttctccccgcccctggaccaggacgactacctgtggggcttggac
gggggtgagggcatcagtgacctcttcgactcctacgacctcggggacctgctgattaat
tga

KEGG   Ailuropoda melanoleuca (giant panda): 100484544
Entry
100484544         CDS       T01329                                 

Gene name
E2F3
Definition
(RefSeq) transcription factor E2F3
  KO
K06620  transcription factor E2F3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01522  Endocrine resistance
aml04110  Cell cycle
aml04218  Cellular senescence
aml04934  Cushing syndrome
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05206  MicroRNAs in cancer
aml05212  Pancreatic cancer
aml05214  Glioma
aml05215  Prostate cancer
aml05218  Melanoma
aml05219  Bladder cancer
aml05220  Chronic myeloid leukemia
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100484544 (E2F3)
   04218 Cellular senescence
    100484544 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100484544 (E2F3)
   05206 MicroRNAs in cancer
    100484544 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100484544 (E2F3)
   05225 Hepatocellular carcinoma
    100484544 (E2F3)
   05226 Gastric cancer
    100484544 (E2F3)
   05214 Glioma
    100484544 (E2F3)
   05220 Chronic myeloid leukemia
    100484544 (E2F3)
   05218 Melanoma
    100484544 (E2F3)
   05219 Bladder cancer
    100484544 (E2F3)
   05215 Prostate cancer
    100484544 (E2F3)
   05224 Breast cancer
    100484544 (E2F3)
   05222 Small cell lung cancer
    100484544 (E2F3)
   05223 Non-small cell lung cancer
    100484544 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100484544 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100484544 (E2F3)
   05161 Hepatitis B
    100484544 (E2F3)
   05160 Hepatitis C
    100484544 (E2F3)
   05163 Human cytomegalovirus infection
    100484544 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100484544 (E2F3)
   05169 Epstein-Barr virus infection
    100484544 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100484544 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100484544 (E2F3)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    100484544 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 100484544
NCBI-ProteinID: XP_034516156
Ensembl: ENSAMEG00000017888
LinkDB
Position
5
AA seq 334 aa
MPLQQQAKRRLELGESGHQYLSDGLKTPKGKGRAALRSPDSPKKKTRYDTSLGLLTKKFI
QLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCSLSEDGG
MLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTYQDIRKISGLK
DQTVIVVKAPPETRLEVPDPVESLQIHLASTQGPIEVYLCPEETETHSPMKTNNQDHNGN
IPKPPSKDLASTNSGHSDCSISMANLSPLASPANLLQQTEDQIPSNLEGPFVNLLPPLLQ
EDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgcccttacagcagcaggcaaagcgaaggctggagctaggagaaagcggtcatcagtac
ctctcagatggcttaaaaacccccaagggcaaaggaagagccgccctgcgaagtccagat
agtccaaaaaaaaaaacacggtatgacacatcacttggtctgctcaccaagaagttcatt
cagctcctgagccagtcccccgacggggtcttggatttgaacaaggcggcggaggtgctg
aaggtgcaaaagaggagaatctatgacatcaccaatgtgctggagggcatccacctcatt
aagaagaagtcgaaaaacaacgtacagtggatgggctgcagtctgtctgaggatgggggc
atgctggcccagtgtcaaggcctgtccaaggaagtgaccgagctcagccaggaggagaag
aaattagatgaactgatccaaagctgcaccctggacctcaaactgctaaccgaagattca
gagaatcaaaggttagcttacgttacatatcaagatattcgaaaaattagtggccttaaa
gaccaaactgttatagttgtcaaagcccctccagaaacaagacttgaagtgcctgaccca
gtagagagcctacaaatacatttggcaagtacccaagggcccattgaggtttatttatgt
ccagaagagacagaaacacacagtccaatgaaaacaaacaaccaagaccacaatgggaat
atcccgaaacccccttccaaagacttggcttcaaccaactcaggacatagcgattgttcg
atttctatggcaaacctttctcctttggcctccccagccaacctcttacagcagactgag
gaccaaattccttccaacctagaaggaccatttgtgaacttactgcctcccctgctccaa
gaagactatctcctaagccttggggaggaagaaggcatcagcgatctctttgatgcttat
gatttggaaaagctcccactggtggaagacttcatgtgtagttga

DBGET integrated database retrieval system