KEGG   Ailuropoda melanoleuca (giant panda): 100475919
Entry
100475919         CDS       T01329                                 

Gene name
MAP2K4
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04620  Toll-like receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04668  TNF signaling pathway
aml04912  GnRH signaling pathway
aml04926  Relaxin signaling pathway
aml04935  Growth hormone synthesis, secretion and action
aml05132  Salmonella infection
aml05135  Yersinia infection
aml05142  Chagas disease
aml05161  Hepatitis B
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05169  Epstein-Barr virus infection
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100475919 (MAP2K4)
   04012 ErbB signaling pathway
    100475919 (MAP2K4)
   04668 TNF signaling pathway
    100475919 (MAP2K4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100475919 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    100475919 (MAP2K4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100475919 (MAP2K4)
   04926 Relaxin signaling pathway
    100475919 (MAP2K4)
   04935 Growth hormone synthesis, secretion and action
    100475919 (MAP2K4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100475919 (MAP2K4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100475919 (MAP2K4)
   05135 Yersinia infection
    100475919 (MAP2K4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100475919 (MAP2K4)
   05161 Hepatitis B
    100475919 (MAP2K4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100475919 (MAP2K4)
   05169 Epstein-Barr virus infection
    100475919 (MAP2K4)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100475919 (MAP2K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100475919 (MAP2K4)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100475919 (MAP2K4)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: STE group
  STE7 family
   100475919 (MAP2K4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH Choline_kinase
Other DBs
NCBI-GeneID: 100475919
NCBI-ProteinID: XP_034503173
Ensembl: ENSAMEG00000013165
LinkDB
Position
17
AA seq 484 aa
MDSLDGNLFFSVLIRVGHPRPGRFCGFAAGRAPRQARAGACQGACPGREGGGAKAGASRA
PRVREAELAALAAAAPLGSSLPTMAAPSPSGGGGSGGGSGSVNELELISFTLGFQINFCE
KAQSKRKALKLNFANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHW
DFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRS
SDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKA
LNHLKENLKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERI
DPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEERE
FSPSFINFVNLCLTKDESKRPKYKELLKHPFILMYEERSVEVACYVCKILDQMPATPSSP
MYVD
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggacagcctggatgggaaccttttcttttcagttcttataagggtcgggcacccgcgc
cctgggcggttctgcggattcgcagctggccgggctccgcgtcaggcgcgggcgggggcg
tgccagggggcgtgtccggggcgggaagggggcggggccaaggcgggcgctagccgcgcc
cctcgcgtgcgagaggccgagcttgctgcattggccgccgcggcgccgctcggctcctca
ctcccaacaatggcggctccgagcccgagcggcggcggcggctccgggggcggcagcggc
agcgtcaatgaactggaacttatctcttttactttaggctttcagataaacttctgtgaa
aaggcacaaagtaaacgcaaagcactgaagttgaattttgcaaatccacctttcaaatct
accgcaaggtttactctgaatcccaaccctacaggagttcaaaacccacacatagagaga
ctgagaacacacagcattgaatcgtcaggaaaactgaagatctcccctgagcaacactgg
gatttcactgcggaggacttgaaagaccttggagaaattggacgaggagcttatggttct
gtcaacaaaatggtccacaaaccaagtgggcaaataatggcagttaaaagaattcggtca
acagtggatgaaaaagaacaaaaacaacttcttatggatttggatgtagtaatgcggagt
agtgattgcccgtacattgttcagttttatggtgcactcttcagagagggtgactgttgg
atctgtatggaactcatgtctacctcgtttgataagttttacaaatatgtatatagtgta
ttagacgatgttattccagaagaaattttaggcaaaatcactttagcaactgtgaaagca
ctaaaccacttaaaagaaaacttgaaaatcattcacagagatatcaaaccttccaatatt
cttctggacaggagtggaaatattaagctctgtgactttggcatcagtggacagctggtg
gactccattgccaagacaagagatgccgggtgtaggccatacatggcacctgaaagaata
gacccgagtgcgtcgcgacaaggatatgacgtccgctctgatgtctggagtttggggatc
acattgtacgagttagccacaggccggtttccttatccaaagtggaatagtgtatttgat
caactcacacaagtcgtcaaaggggaccctccacagctgagtaactctgaagaaagggag
ttctccccgagcttcatcaactttgtcaacttgtgccttacgaaggatgaatccaaaagg
ccaaagtataaagaacttctgaaacatccctttattttgatgtatgaagagcgtagcgta
gaggtcgcctgctacgtgtgtaaaatcctggatcagatgccagcgacccccagctctccc
atgtacgtcgactga

DBGET integrated database retrieval system