KEGG   Ailuropoda melanoleuca (giant panda): 100475938
Entry
100475938         CDS       T01329                                 

Gene name
IL1R2
Definition
(RefSeq) interleukin-1 receptor type 2 isoform X2
  KO
K04387  interleukin 1 receptor type II
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04060  Cytokine-cytokine receptor interaction
aml04640  Hematopoietic cell lineage
aml05146  Amoebiasis
aml05166  Human T-cell leukemia virus 1 infection
aml05202  Transcriptional misregulation in cancer
aml05215  Prostate cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100475938 (IL1R2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100475938 (IL1R2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100475938 (IL1R2)
  09162 Cancer: specific types
   05215 Prostate cancer
    100475938 (IL1R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100475938 (IL1R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100475938 (IL1R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100475938 (IL1R2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:aml04050]
    100475938 (IL1R2)
   04090 CD molecules [BR:aml04090]
    100475938 (IL1R2)
Cytokine receptors [BR:aml04050]
 Interleukin receptor families
  IL1 receptor family
   100475938 (IL1R2)
CD molecules [BR:aml04090]
 Proteins
  100475938 (IL1R2)
SSDB
Motif
Pfam: ig Ig_3 Ig_2 I-set Ig_6 V-set Ig_5 Izumo-Ig LPD11
Other DBs
NCBI-GeneID: 100475938
NCBI-ProteinID: XP_011229213
Ensembl: ENSAMEG00000013088
LinkDB
Position
4
AA seq 413 aa
MQGCRLRSAGPVLSTSYVLQKLPETMFILYMLIMSISASTIQPEEHTAAENCQFLGKHFK
TDFRVEGEPVVLRCPQVQLWLWASVSPHVNVTWRKNDSDRTIPGEEETRMWIQDGALWIL
PALQKDSGTYICTVRNSSYCSEMSVELRVFEKTEASLPFISYPQILTLSTSGSLVCPELS
EFTHNKMDMKIQWYKDSVLLDQDNEKFLSVRGTSRLLIHNVSVEDAGYYSCAMTFTHEGI
PYNVTRNIELRVNKKEEETIPVIISPHQTILASLGSRLTIPCKVFLGAGTQSTTMLWWMA
NNTRIENAYQGGRVAEGQRQEYSENNENYIDVPLVFDPVIREDLNTDFKCLVRNTLSFQT
LRTTVKEATTFSWGTVLAPLSLVCLVLVGIWMHRRCKHRTGKAYGLTTLKTGH
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgcagggctgcaggctacggagtgctggacctgtgctctctacctcctatgtcctccag
aagttgccagaaacaatgttcatcttgtacatgttgataatgagtatttcagcctccacc
attcagcctgaggaacatacagctgcagaaaactgccaatttcttggcaagcatttcaaa
actgacttcagggtggaaggggagcctgtggtcctgaggtgcccccaggtgcagctctgg
ttgtgggcatctgtcagcccccacgtcaacgtgacatggcgtaagaacgattctgataga
acaatcccaggggaagaagagacgcgaatgtggatccaggatggtgctctctggatcttg
ccagccttgcagaaagactctggcacctacatctgcactgtcagaaattcttcttactgt
agtgaaatgtccgttgagctccgggttttcgagaagacagaagcttccctgcctttcata
tcgtacccgcaaattctaaccttgtcaacctctgggtccttagtttgccctgagctgagt
gaattcacccataacaaaatggacatgaagattcagtggtacaaggattctgtccttttg
gatcaagacaacgagaagtttctaagtgtgaggggaacctctcgcttactcatccataat
gtgtctgtggaggacgcaggttattacagctgtgccatgacattcacccatgaaggcata
ccatacaacgtgactaggaatatcgaactacgtgtcaacaaaaaagaagaggagacgatt
cctgtgattatctccccgcaccagaccatattagcttcattgggatcaagattgacaatc
ccgtgtaaggtgtttctgggagctgggacacagtcgaccaccatgctctggtggatggcc
aacaacaccagaatagagaacgcctaccagggaggccgcgtggccgaggggcagcgccag
gagtactcagagaacaatgagaactacatcgatgtgccgctggtttttgatccagtcata
agagaggatttgaacacggattttaaatgccttgtccgtaacacacttagttttcagacg
ctgcgtaccacagtcaaagaagctaccacattctcctgggggaccgtgctggcccccctc
tccctggtctgcttggttttggtgggaatatggatgcacagacggtgtaaacacagaact
ggaaaagcatacggtttgaccacgttaaagactggccactaa

DBGET integrated database retrieval system