KEGG   Ailuropoda melanoleuca (giant panda): 100475939Help
Entry
100475939         CDS       T01329                                 

Gene name
HKDC1
Definition
(RefSeq) hexokinase domain containing 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00010  Glycolysis / Gluconeogenesis
aml00051  Fructose and mannose metabolism
aml00052  Galactose metabolism
aml00500  Starch and sucrose metabolism
aml00520  Amino sugar and nucleotide sugar metabolism
aml00524  Neomycin, kanamycin and gentamicin biosynthesis
aml01100  Metabolic pathways
aml01200  Carbon metabolism
aml04066  HIF-1 signaling pathway
aml04910  Insulin signaling pathway
aml04930  Type II diabetes mellitus
aml04973  Carbohydrate digestion and absorption
aml05230  Central carbon metabolism in cancer
Module
aml_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aml_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100475939 (HKDC1)
   00051 Fructose and mannose metabolism
    100475939 (HKDC1)
   00052 Galactose metabolism
    100475939 (HKDC1)
   00500 Starch and sucrose metabolism
    100475939 (HKDC1)
   00520 Amino sugar and nucleotide sugar metabolism
    100475939 (HKDC1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    100475939 (HKDC1)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    100475939 (HKDC1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100475939 (HKDC1)
  Digestive system
   04973 Carbohydrate digestion and absorption
    100475939 (HKDC1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100475939 (HKDC1)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100475939 (HKDC1)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     100475939 (HKDC1)
Membrane trafficking [BR:aml04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100475939 (HKDC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 VPS13_mid_rpt
Motif
Other DBs
NCBI-GeneID: 100475939
NCBI-ProteinID: XP_002913773
Ensembl: ENSAMEG00000017949
LinkDB All DBs
Position
Un
AA seq 917 aa AA seqDB search
MFAVHLMAFYFSKLKEDQIKKVDRFLYDMRLSDETLLDIMARFQAEMQKGLGKDTNPTAA
VKMLPTFVRAIPDGSENGEFLSLDLGGSKFRVLKVQVSQEGKRNVQMESQFYPTPNEIIR
GNGSELFDYVADCLADFMKTKGLKHKKLPLGLTFSFPCRQTKLEEGILLSWTKKFKARGV
QGTDVVSCLTKAMRKHKDIDVDILALVNDTVGTLMTCAYDDPYCEVGVIIGTGTNACYME
DMSNIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDRELDLGSLNPGKQLFEKMISGL
YLGELVRIILLKMAKAGLLFGGEKSSALHTKGKIETRHVAAMEKYKEGLANTREILTDLG
LEPSEADCIAVQHVCTIVSFRSANLCAAALAAILTRLRVNKKLARLRTTVGMDGTVYKIH
PQYPKRLHKVVRRLVPNCDVRFLLSESGSTKGAAMVTAVASRVQAQRKQIDKVLALFQLT
REQLEDVQGKMRAEFEYGLKKDTHLTATVKMLPTYVCGMPDGTEKGKFLALDLGGTNFRV
LLVKIRSGRRSVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLDYMGLKGAQLPLGFT
FSFPCRQTSIDKGTLIEWTKGFKATDCEGEDMVDMLREAIKRRNEFDLDIVAVVNDTVGT
MMTCGHEDPNCEIGLIAGTGSNMCYMEEMRNIELVEGDEGKMCINTEWGGFGDNGCIDDI
RTQYDKKVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKQGLLFRGQISERLRTRGI
FETKFLSQIESDRLALLQVRRILQQLGLDSTCEDSIVVKEVCGAVSRRAAQLCGAGLAAV
VEKRREDQGLEYLKITVGVDGTLYKLHPHFSRILQETVKELAPRCDVTLMLSEDGSGKGA
ALITAVAKRLQQAQKEN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcggtacatttgatggcattttacttcagcaagctgaaggaagatcagatcaag
aaggtggacaggttcctgtatgacatgcggctctccgatgagacccttttggacatcatg
gctcgcttccaggctgaaatgcagaagggcctggggaaggacaccaaccccacagccgcc
gtgaagatgcttcccacctttgtcagggccattccagatggctcagaaaatggggaattt
ctttctctggatcttggagggtccaaatttcgtgtcttgaaggtacaagtctctcaagag
gggaaaagaaacgtccagatggagagtcagttctacccaacacccaatgaaattatccga
ggcaatggctccgagctgtttgactacgtagctgactgtctggcagatttcatgaagacg
aaagggttgaagcataagaaattgccccttggcctaaccttctcttttccgtgcagacag
actaagttggaagaggggatcctgctttcatggaccaagaagtttaaggcacggggagtt
caaggcacagatgtcgtgagttgtctgaccaaagccatgagaaaacacaaggacatagac
gtggacatcctggccttggtcaatgacaccgtggggaccctgatgacatgcgcctatgat
gatccctactgtgaagttggtgtcatcattggcaccggcaccaacgcgtgttacatggag
gacatgagcaacattgacctggtggagggcgatgaggggaggatgtgtatcaacacggag
tggggggccttcggcgacgacgggtccctggaagacatccgcaccgagttcgaccgggag
ctggacctcggctctctcaaccctgggaagcaactgtttgagaagatgatcagtggcctg
tacctgggtgaacttgtcaggatcatcttgctgaagatggccaaggcaggtctcctgttt
ggcggcgagaagtcctctgctctccacacaaagggcaagattgaaacacggcacgtggct
gccatggagaagtataaggaaggccttgccaatacaagagagatcctgacagatctgggc
ctggagccttcagaggccgactgcattgcggtccagcacgtctgcaccatcgtctccttc
cgttcagccaacctgtgtgcagcggccctggcagccatcctgacgcgcctccgggtgaac
aagaagctggcgcggctccgcaccacagtgggcatggacggcacggtctacaagatacac
cctcaataccccaaacgcctgcacaaggtggtgaggagactggtcccgaactgtgacgtc
cgcttcctcttgtcggagagtggcagcaccaagggggctgccatggtgacagcggtggcc
tcccgagtgcaggcccagcggaagcagatcgacaaggtgctggctctgttccagctgact
cgagagcagcttgaggatgtgcagggcaagatgcgggctgagttcgagtacgggctgaaa
aaggacacccacctgacggccacagtcaagatgctgcccacctacgtctgcgggatgccg
gatggcacagagaaaggaaagttccttgccctggatctggggggaaccaacttccgggtc
ctcctggtaaagatcagaagtggacggaggtcggtgcgaatgtacaacaagatctttgcc
atccccttggagatcatgcagggcaccggcgaggagctgttcgaccacatcgtgcagtgc
attgctgacttcctagactacatgggcctcaagggagcccagctgcctttgggcttcacg
ttctcatttccctgcaggcagacgagcatcgacaagggaacgctcattgagtggaccaaa
ggcttcaaggccacggattgtgaaggggaagacatggtggacatgctcagggaagccatt
aagaggagaaatgagttcgacctggacatagttgcagttgtgaatgacacagtgggtacc
atgatgacctgcggccatgaagatcctaattgtgagattggcctgattgcaggaacaggc
agcaacatgtgctacatggaggagatgaggaacattgaactggtggaaggggacgaaggg
aagatgtgcattaacacagagtggggaggatttggagataatggctgcatagacgacatc
cggacacaatatgacaagaaggtggatgaggggtccttgaaccctggcaaacagagatat
gagaaaatgaccagtgggatgtacctgggggagattgtgcggcagattctgatcgacctg
accaagcagggtctccttttccgtgggcagatttcagagcgtctccggaccaggggcatc
tttgaaaccaagttcctgtcccagattgaaagtgatcgactggccctcctccaggtcagg
aggatcctgcagcagctcggcctggacagcacatgtgaggacagcattgtggtgaaggag
gtgtgcggagctgtgtcccggcgggcagcccagctctgcggcgccggcctggctgctgtc
gtggagaagaggagggaagaccaggggctggagtacctgaagatcaccgtgggagtggat
ggcacgctgtacaagctgcacccgcacttttctcggatattgcaggaaactgtgaaagag
ctagctcctcgatgtgatgtgacgctcatgctgtccgaagatgggagtggaaagggagct
gctctgatcactgctgtggccaagaggttacagcaggcccagaaggagaactag

DBGET integrated database retrieval system