KEGG   Ailuropoda melanoleuca (giant panda): 100476206Help
Entry
100476206         CDS       T01329                                 

Gene name
GYS1
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00500  Starch and sucrose metabolism
aml01100  Metabolic pathways
aml04151  PI3K-Akt signaling pathway
aml04152  AMPK signaling pathway
aml04910  Insulin signaling pathway
aml04922  Glucagon signaling pathway
aml04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100476206 (GYS1)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100476206 (GYS1)
   04152 AMPK signaling pathway
    100476206 (GYS1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100476206 (GYS1)
   04922 Glucagon signaling pathway
    100476206 (GYS1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100476206 (GYS1)
Enzymes [BR:aml01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100476206 (GYS1)
Glycosyltransferases [BR:aml01003]
 Polysaccharide
  Storage polysaccharide
   100476206 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 100476206
NCBI-ProteinID: XP_002917902
Ensembl: ENSAMEG00000014540
UniProt: D2H7X7
LinkDB All DBs
Position
Un
AA seq 737 aa AA seqDB search
MPLSRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGSPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQNEEKPHVVAHFH
EWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPEHFIYEPHEADATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDGPPDVDGERYDEDEEAAKDRRNIRAPEWPRRASCASSTGGSKRGSVDTAPSSSLS
TPSEPLSPASSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaagtcgcactttgtccatgtcctccctgccaggactggaggattgggaggat
gaattcgacctggagaacacagtgctcttcgaggtggcctgggaggtggccaacaaggtg
ggaggcatctacacggtcctgcagacgaaggcgaaggtgacaggggatgagtggggcgac
aactactacctggtgggaccttacacggagcagggcgtgaggacccaggtggaactgctg
gaacccccaactccggccctgaagaggacgctggactccatgaacagcaagggctgcaag
gtgtactttggtcgctggctgatcgaggggagccctctggtggtgctcctggatgtgggg
gcctcagcctgggccctggaacgctggaagggggagctctgggacacctgcaacatcggg
gtgccctggtacgaccgtgaggccaacgacgccgtcctttttggcttcctcacaacctgg
ttcctgggtgagttcctggcccagaatgaggagaagccacatgtggttgcacacttccac
gagtggttagcgggcatcggactctgcctgtgccgggcccggcggctgcctgtggctaca
atcttcaccacccatgccacgctcctgggacgatatctgtgtgcgggtgctgtggacttc
tacaacaacctggagaatttcaatgtggacaaggaagcaggtgagaggcaaatctatcac
cgctactgcatggagcgggcagcggcccactgcgctcacgtctttactactgtgtcccag
attaccgccattgaggctcagcacctactcaagaggaaaccagatatcgtgacccccaat
gggctgaatgtgaaaaagttctccgccatgcatgagttccagaacctccatgctcaaagc
aaggctcgaatccaggagtttgtgcggggccatttttatggacacctggacttcaacttg
gacaagaccttgtatttctttatcgctggccgctacgagttctctaacaagggggccgac
gtcttcctagaggccttggcccggctcaactatctgctcagagtgaacggcagtgagcag
acggtcgttgccttcttcatcatgccggctcggaccaacaatttcaatgtggaaaccctc
aagggccaggccgtgcgcaagcagctctgggatacggccaacactgtgaaagagaagttc
ggaaggaagctttatgaatccttgctggtggggagcctcccggacatgaacaagatgctg
gacaaggaggacttcaccatgatgaagagagccatctttgccacgcagaggcagtccttc
ccccctgtgtgcacccacaacatgctggacgactcctcggaccctatcctgaccaccatc
cgccgaattggacttttcaatagtagtgctgacagggtcaaggtgattttccacccagag
ttcctctcctccacaagccccctgctccccgtggattatgaggaatttgtccgtggctgc
catcttggggtcttcccctcctactatgagccttggggctacacgccagctgagtgcacc
gttatgggtatccccagtatctccaccaacctctccggcttcggctgcttcatggaggaa
cacattgcagacccctcagcttacggcatctacattctggaccggcggttccgtagtctc
gatgattcctgctcgcagctcacctccttcctctacagcttctgccagcagagccggcgg
cagcgcatcatccagcgaaaccgcaccgagcgcctctcagaccttctggactggaaatac
ctaggccggtactatatgtctgcgcgccacatggcgctggccaaggcctttccagaacac
ttcatctatgagccccacgaggctgacgcgactcagggctaccgctacccacggccggcc
tcggtgccaccatcgccctcgctgtcgcgacactcaagcccacaccagagtgaggacgag
gaggagccccgggacgggccccctgatgtagacggggagcgctacgacgaggacgaggag
gccgccaaggaccggcgcaacatccgcgcccccgaatggccgcgccgcgcctcctgcgcc
tcttccaccggcgggagcaagcgcggctcggtggacacggcgccctccagctcgctcagc
actcccagtgagcccctcagccctgccagctccctgggcgaggagcgcaactga

DBGET integrated database retrieval system