KEGG   Ailuropoda melanoleuca (giant panda): 100476536
Entry
100476536         CDS       T01329                                 

Gene name
MLH1
Definition
(RefSeq) DNA mismatch repair protein Mlh1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01524  Platinum drug resistance
aml03430  Mismatch repair
aml03460  Fanconi anemia pathway
aml05200  Pathways in cancer
aml05210  Colorectal cancer
aml05213  Endometrial cancer
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    100476536 (MLH1)
   03460 Fanconi anemia pathway
    100476536 (MLH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100476536 (MLH1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100476536 (MLH1)
   05226 Gastric cancer
    100476536 (MLH1)
   05213 Endometrial cancer
    100476536 (MLH1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100476536 (MLH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:aml03400]
    100476536 (MLH1)
DNA repair and recombination proteins [BR:aml03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     100476536 (MLH1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 100476536
NCBI-ProteinID: XP_034518147
Ensembl: ENSAMEG00000017905
LinkDB
Position
6
AA seq 755 aa
MSLVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVVVKEGGLKLIQ
IQDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTA
DAKCAYRANYSDGKLKAPPKPCAGNQGTQITVEDLFYNISTRRKALKNPSEEYGKILEVV
GRYSIHNSGISFSVKKQGETVADVRTLPSATRVDNIRSIFGNAVSRELIEVGCEDKTLAF
KMNGYISNANYSVKKCIFLLFINHRLVESASLRKAIETVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEDSILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGSSVEVV
KSTTGVTPSSTGSGDKVYAHQMVRTDSREQKLDAFLQPMSKALSSQPQAIVPEDRTDASS
GGAGQQDEEMLELPEPAQVAATNQGTEVDVTEGTSEMSEKRGPSSSPGNPRKRPRESSDV
EMVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINERGHETLREMLHNHSFVGCVNPQWA
LAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSHPLFDLAMLALDSPESGWTEED
GPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLIGLPLLIDNYVPPLEGLPIFILRLA
TEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVSGSSAKPWKWTVEHIVY
KAFRSHLLPPKHFTEDGNILQLANLPDLYKVFERC
NT seq 2268 nt   +upstreamnt  +downstreamnt
atgtcgctcgtagcgggggttattcggcggttggacgagacagtggtgaaccgcatcgcg
gcaggggaagttattcagcggccggctaatgccatcaaggagatgattgagaactgttta
gatgcaaaatccaccagtatccaagtggttgttaaagagggaggcctcaaactgattcag
atccaagacaatggcactgggatcaggaaagaagatctggatattgtgtgtgagaggttc
actacaagtaaactgcagtcctttgaggatttagctagtatttctacctatggctttcgg
ggtgaggctttggccagcatcagccacgtggctcatgttactattacaaccaaaacagct
gatgcaaagtgcgcctacagagcaaattattcagatggaaagctgaaagctcctcctaaa
ccatgtgcaggcaatcaggggacccagatcacggtggaggaccttttttacaacatatcc
acgaggaggaaagctttaaaaaatccaagtgaagaatatgggaaaatattggaagttgtt
ggcaggtattcaatacacaattcaggcattagtttctcagttaaaaaacaaggtgagacc
gtagctgacgttaggacactgcccagtgccacaagagtggacaatattcgctccatcttt
ggaaatgctgttagccgagaactgatagaagttgggtgtgaggataaaaccctagccttc
aaaatgaatggctacatatccaatgcaaattactcggtgaagaagtgcatcttcttactc
ttcatcaaccatcgtctggtagagtcagcttccttaagaaaagccattgaaacagtgtat
gcagcatatttgcccaaaaacacacacccatttctgtacctcagcttagagatcagcccc
cagaacgtggatgtcaatgtacaccccacaaagcatgaagttcacttcctgcacgaggac
agcatcctggagcgggtgcagcagcacattgagagcaagctcctgggctccaactcctcc
aggatgtacttcacccagactttactaccaggtcttgctggctcctctgtggaggtggtt
aaatccacaacgggtgtgaccccctcatctactggaagtggcgacaaggtctacgcccac
cagatggtccgcacagattcacgggaacagaagctcgatgcctttctgcagcccatgagc
aaggctctgtccagtcagcctcaggccattgtcccagaagacaggactgatgcttccagt
ggtggggctgggcagcaagatgaggaaatgcttgaactcccagagcctgctcaagtggct
gccacaaatcagggcacagaggtggatgtgacagaggggacctcggaaatgtcagagaag
agaggtccctcttccagcccaggcaaccccagaaagaggcctcgggaaagctctgatgtg
gaaatggtggaagatgattcccgaaaggaaatgacagcagcgtgtacccctcggcgcagg
atcatcaacctcaccagtgtgctgagcctccaggaagaaattaacgagcggggacatgag
acgctccgagagatgctgcataaccactcctttgtgggctgcgtgaatccgcagtgggcc
ttggcacagcatcagaccaagttataccttctcaacaccaccaaactgagtgaagaactg
ttctaccagatactcatttatgattttgccaattttggtgttctgagactctcgcacccg
ctgtttgacctggccatgctcgccttggatagtcctgagagtggttggacggaggaagat
ggtcccaaagaaggacttgctgagtacattgttgagtttctgaagaagaaggctgagatg
cttgcagactatttctctttggaaatcgatgaggaggggaacctgattggattacccctg
ctgatcgacaactacgtgccccctttggagggtctgcctatcttcattcttcgactagcc
acagaggtgaactgggatgaagagaaggaatgttttgaaagcctcagtaaagaatgtgct
atgttttactccattcggaagcagtatatatctgaggagtcaaccctctcaggccagcag
agtgaagtgtctggctcctctgcaaagccctggaagtggactgtggaacacatcgtctat
aaagccttccgctcacatcttctgcctcccaaacatttcacagaagatggaaatatccta
cagcttgctaacctgcccgatctgtacaaagtcttcgagcggtgttaa

DBGET integrated database retrieval system