KEGG   Ailuropoda melanoleuca (giant panda): 100477070Help
Entry
100477070         CDS       T01329                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00052  Galactose metabolism
aml00500  Starch and sucrose metabolism
aml01100  Metabolic pathways
aml04142  Lysosome
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100477070 (GAA)
   00500 Starch and sucrose metabolism
    100477070 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100477070 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    100477070 (GAA)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100477070 (GAA)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100477070 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 100477070
NCBI-ProteinID: XP_002921833
Ensembl: ENSAMEG00000015157
UniProt: G1M9I4
LinkDB All DBs
Position
Un
AA seq 952 aa AA seqDB search
MDVRWPPSSRPLLGVCTLVCLATAAFLGHVLLRDFLVVPQEQCGFSQVPEELYHAPQQGA
RDPGPQPTPGHHGSPRAARTQCDVPPNSRFDCAPDKAITQEQCEARGCCYRPARQWPRAP
RMGQPWCFFPPSYPSYKLENLTTTETGYTAALTRTTRTFFPKDILTLQLDLLLETESRLH
FSIKDPANRRYEVPLETPRVRSRASSTLYSVEFQEEPFGVVVRRKLDGRVLLNTTVAPLF
FADQFLQLSTSLPSRHLVGLAEHLGSLTLSTNWTKITLWNRDIAPSPNVNLYGSHPFYLL
LEDGGSAHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYVFLGPEPKRVVQQYLEVVGY
PFMPPYWGLGFHLCRWGYSSTAITRQVVENMTRARFPLDTQWNDLDYMDARRDFTFNKDG
FRDFPAMVQELHQGGRHYVMIVDPAISSSGPPGSYRPYDDGLQRKVFITNETGQPLIGKV
WPGFTAFPDFTSPEALDWWQDMVSEFHAQVPFDGMWIDMNEPSNFVKGSVDGCPDNDLEN
PPYVPGVVGGTLRAATICASSRQFLSTHYNLHNLYGLTEAFASHRALVKARGTRPFVISR
SNFAGHGRYAGHWTGDVWSSWEQLSYSVPEILLFNLLGVPLVGADVCGFLGNTSEELCVR
WTQLGAFYPFMRNHNDLNSLPQEPYRFSETAQEAMRKALALRYALLPFLYSLFHRAHVLG
ETVARPLFLEFPEDPRTWTVDRQLLWGPALLITPVLEAGKVEVTGYFPPGMWYDLQAVPV
EAFSSLPPPPRAPLTPVIHSKGQWVTLPAPLDTINLHLRAGHVIPLQGPGLTTTESRKQP
MGLLAALTMNGEARGELFWDDGESLGVLERGDYTKVIFLARNNTIMNELVHVTSEGAGLQ
LRKVTVLGVATAPSQVLSNGVPVSNFTYSPDTKTLDIPVSLTMGEQFLISWS
NT seq 2859 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgaggtggcctcccagctcccgccccctcctgggggtctgcaccctcgtctgc
ctggccaccgctgccttcctggggcatgtcctgctccgtgatttcttggtggtcccccaa
gagcagtgtggcttctcccaagtacccgaggagctttatcatgctccccagcagggagcc
cgtgacccaggcccccagcccaccccagggcaccacggcagtccccgagcagcacgcaca
cagtgtgacgtgccccccaacagccgcttcgactgtgcccctgacaaggccatcacccag
gaacagtgtgaggcccggggctgctgctaccggcctgcaaggcagtggcctcgggccccc
cggatggggcagccctggtgcttcttcccacccagctacccgagttacaagctggagaac
ctgaccaccacggagacgggctacacggccgccctgacccgcaccacccgaaccttcttc
cccaaggacatcttgaccttacagctggacctgctgctggagacggagagccggcttcac
ttctcgatcaaggatcccgccaacaggcgctatgaggtgcccctggagaccccgcgtgtc
cgcagccgggcctcgtccacactgtacagcgtggagttccaggaggagcccttcggggtg
gtcgtgcgccggaagctggacggccgggtgctgctgaacacgacggtggcccccctgttc
ttcgccgaccagtttctgcagctgtccacgtccctgccgtcccggcaccttgtgggcctt
gccgagcacctcggctccctcacgctcagcaccaactggaccaagatcactctctggaac
cgggacatcgccccctcgcccaatgtgaacctgtacgggtcccaccctttctacctgctg
ctggaggacggcgggtcggctcacggggtcttcctgctgaacagcaacgccatggacgtg
gtcctgcagccgagcccagccctcagctggaggtcgacaggtgggatcctggacgtgtac
gtcttcctgggccctgagcccaagcgcgtggtgcagcagtacctggaagtcgtgggctac
ccgttcatgccgccgtactggggcctgggcttccacctctgccgctggggctactcctcc
accgccatcacccgccaggtggtggagaacatgaccagggcccgcttccccctggacacg
cagtggaatgacctggactacatggacgccaggagggacttcaccttcaacaaggacggt
ttcagggacttcccggccatggtgcaggagctccaccagggtggccggcactacgtgatg
atcgtggaccctgccatcagcagctccggcccccccggcagctaccgaccctacgacgac
ggtctgcagaggaaggttttcatcaccaatgagactgggcagcctctgattgggaaggtg
tggcccggattcaccgccttccccgacttcaccagccccgaggctctggactggtggcag
gacatggtgtctgagttccacgcccaggtgccctttgacggcatgtggatcgacatgaac
gagccatccaacttcgtaaagggttctgtggacggctgccctgacaatgacctggagaac
ccaccctacgtgccaggggtggtgggtgggaccctgcgggccgccaccatctgtgcctcc
agccgccagttcctctccacgcactacaacctgcacaacctgtacggcctgacggaagcc
ttcgcctcgcacagggcccttgtgaaggctcgggggacgcggccctttgtgatctcccgc
tcaaacttcgctggccacggccgatacgccggccactggacgggggacgtgtggagcagc
tgggagcagctctcgtactccgtgccagaaatcctgctgttcaaccttctgggggtgccg
ctggtcggggccgacgtctgtggcttcctgggcaacacctcggaggagctgtgtgtgcgc
tggacccagctgggggccttctacccgttcatgcggaatcataacgacctcaacagcctg
cctcaggagccatacaggttcagcgagacggcacaggaagccatgcggaaggctctcgcc
ctgcgctacgcgctgctgcccttcctctactcgctgttccaccgggcccacgtcctaggc
gagactgtggcccggcccctcttcctggagttccccgaggacccccgcacctggaccgtg
gaccgccagctgctgtgggggccggctctgctcatcacccccgtgcttgaggctgggaag
gtcgaagtgactggctacttcccccccggcatgtggtacgacctgcaggcggtgccagta
gaggccttcagcagcctcccacctccacctcgggctcctctcacgcccgtcatccacagc
aaggggcagtgggtgacgctgccggccccgctggacaccatcaacctccacctccgggcg
gggcacgtcatccccctgcagggccctggcctcacaacgacggagtcccggaagcagccc
atgggtttgctcgcagccctgaccatgaacggggaggcccgaggggagctgttctgggat
gacggggagagcctgggggtgctggagcgtggggactacacgaaggtcatcttcctggcc
aggaataacaccatcatgaacgagctggtgcatgtgactagtgagggggctggcctgcag
ctgaggaaggtgaccgtcctgggggtggccacggcccccagccaggtcctctccaatggt
gtccctgtctccaacttcacctacagccccgacaccaagaccctggacatccctgtctca
ctgacgatgggagagcagtttctcatcagttggtcttaa

DBGET integrated database retrieval system