KEGG   Ailuropoda melanoleuca (giant panda): 100477151
Entry
100477151         CDS       T01329                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6 precursor
  KO
K05405  interleukin 6
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml01523  Antifolate resistance
aml04060  Cytokine-cytokine receptor interaction
aml04061  Viral protein interaction with cytokine and cytokine receptor
aml04066  HIF-1 signaling pathway
aml04068  FoxO signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04218  Cellular senescence
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04623  Cytosolic DNA-sensing pathway
aml04625  C-type lectin receptor signaling pathway
aml04630  JAK-STAT signaling pathway
aml04640  Hematopoietic cell lineage
aml04657  IL-17 signaling pathway
aml04659  Th17 cell differentiation
aml04668  TNF signaling pathway
aml04672  Intestinal immune network for IgA production
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml05010  Alzheimer disease
aml05020  Prion disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05132  Salmonella infection
aml05133  Pertussis
aml05134  Legionellosis
aml05135  Yersinia infection
aml05142  Chagas disease
aml05143  African trypanosomiasis
aml05144  Malaria
aml05146  Amoebiasis
aml05152  Tuberculosis
aml05161  Hepatitis B
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05321  Inflammatory bowel disease
aml05323  Rheumatoid arthritis
aml05332  Graft-versus-host disease
aml05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100477151 (IL6)
   04668 TNF signaling pathway
    100477151 (IL6)
   04066 HIF-1 signaling pathway
    100477151 (IL6)
   04068 FoxO signaling pathway
    100477151 (IL6)
   04151 PI3K-Akt signaling pathway
    100477151 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100477151 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100477151 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100477151 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100477151 (IL6)
   04620 Toll-like receptor signaling pathway
    100477151 (IL6)
   04621 NOD-like receptor signaling pathway
    100477151 (IL6)
   04623 Cytosolic DNA-sensing pathway
    100477151 (IL6)
   04625 C-type lectin receptor signaling pathway
    100477151 (IL6)
   04659 Th17 cell differentiation
    100477151 (IL6)
   04657 IL-17 signaling pathway
    100477151 (IL6)
   04672 Intestinal immune network for IgA production
    100477151 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100477151 (IL6)
   05202 Transcriptional misregulation in cancer
    100477151 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100477151 (IL6)
   05321 Inflammatory bowel disease
    100477151 (IL6)
   05332 Graft-versus-host disease
    100477151 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100477151 (IL6)
   05020 Prion disease
    100477151 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    100477151 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100477151 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100477151 (IL6)
   04931 Insulin resistance
    100477151 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100477151 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100477151 (IL6)
   05135 Yersinia infection
    100477151 (IL6)
   05133 Pertussis
    100477151 (IL6)
   05134 Legionellosis
    100477151 (IL6)
   05152 Tuberculosis
    100477151 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100477151 (IL6)
   05161 Hepatitis B
    100477151 (IL6)
   05171 Coronavirus disease - COVID-19
    100477151 (IL6)
   05164 Influenza A
    100477151 (IL6)
   05162 Measles
    100477151 (IL6)
   05168 Herpes simplex virus 1 infection
    100477151 (IL6)
   05163 Human cytomegalovirus infection
    100477151 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100477151 (IL6)
   05169 Epstein-Barr virus infection
    100477151 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100477151 (IL6)
   05144 Malaria
    100477151 (IL6)
   05142 Chagas disease
    100477151 (IL6)
   05143 African trypanosomiasis
    100477151 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100477151 (IL6)
   01523 Antifolate resistance
    100477151 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100477151 (IL6)
Cytokines and growth factors [BR:aml04052]
 Cytokines
  Interleukins
   100477151 (IL6)
SSDB
Motif
Pfam: IL6 GCSF IL11 IL23
Other DBs
NCBI-GeneID: 100477151
NCBI-ProteinID: NP_001291851
Ensembl: ENSAMEG00000003313
UniProt: H2DL91
LinkDB
AA seq 211 aa
MNSLSTSAFSPVAFSLGLLLVMATALPTPGHLGRDSKDEATSNRPPLISADKMEIIKYIL
GRISALKKEMCDKYNKCEDSKEALAENNLHLPKLAKKDGCFQSGFNQDTCLTRIATGLLE
FQVHLKYLQANYEGDKENANSVYFSTKVLLQMLMEKVKNQDEVTTPDPTTDTGLQAILKS
QDKWLKQTTIHLILRNLEDFLQFSLRAVRVM
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaactccctctccacaagcgccttcagtccagttgccttctccctggggctgctcctg
gtgatggctactgctctccctaccccgggacacctgggaagagattccaaagatgaggcc
acctcaaatagaccaccactcatctctgcagacaaaatggaaatcattaaatacatcctc
ggcagaatctctgcactgaaaaaggagatgtgtgacaagtataacaagtgtgaagacagc
aaggaggcactggcagaaaataacttacatcttccaaaactggcaaaaaaggacggatgc
ttccaatctgggttcaatcaggacacctgcctgacaagaatcgctaccggtcttctggag
tttcaggtacacctgaaatacctccaggccaactatgaaggtgataaggaaaatgccaac
tctgtgtacttcagtaccaaagtcctgctccagatgctgatggaaaaggtaaagaatcag
gatgaagtgaccacccccgaccccaccacagacaccggcctgcaggctatcctgaagtcg
caggacaagtggctgaagcaaacaacaattcacctcatcctgcggaaccttgaggatttc
ctgcagttcagcctgagggctgtgcgggtcatgtag

DBGET integrated database retrieval system