KEGG   Ailuropoda melanoleuca (giant panda): 100477326
Entry
100477326         CDS       T01329                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha type
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04066  HIF-1 signaling pathway
aml04070  Phosphatidylinositol signaling system
aml04071  Sphingolipid signaling pathway
aml04072  Phospholipase D signaling pathway
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04261  Adrenergic signaling in cardiomyocytes
aml04270  Vascular smooth muscle contraction
aml04310  Wnt signaling pathway
aml04360  Axon guidance
aml04370  VEGF signaling pathway
aml04510  Focal adhesion
aml04540  Gap junction
aml04613  Neutrophil extracellular trap formation
aml04650  Natural killer cell mediated cytotoxicity
aml04664  Fc epsilon RI signaling pathway
aml04666  Fc gamma R-mediated phagocytosis
aml04670  Leukocyte transendothelial migration
aml04713  Circadian entrainment
aml04720  Long-term potentiation
aml04723  Retrograde endocannabinoid signaling
aml04724  Glutamatergic synapse
aml04725  Cholinergic synapse
aml04726  Serotonergic synapse
aml04727  GABAergic synapse
aml04728  Dopaminergic synapse
aml04730  Long-term depression
aml04750  Inflammatory mediator regulation of TRP channels
aml04911  Insulin secretion
aml04912  GnRH signaling pathway
aml04916  Melanogenesis
aml04918  Thyroid hormone synthesis
aml04919  Thyroid hormone signaling pathway
aml04921  Oxytocin signaling pathway
aml04925  Aldosterone synthesis and secretion
aml04926  Relaxin signaling pathway
aml04928  Parathyroid hormone synthesis, secretion and action
aml04929  GnRH secretion
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04935  Growth hormone synthesis, secretion and action
aml04960  Aldosterone-regulated sodium reabsorption
aml04961  Endocrine and other factor-regulated calcium reabsorption
aml04970  Salivary secretion
aml04971  Gastric acid secretion
aml04972  Pancreatic secretion
aml05017  Spinocerebellar ataxia
aml05022  Pathways of neurodegeneration - multiple diseases
aml05031  Amphetamine addiction
aml05032  Morphine addiction
aml05143  African trypanosomiasis
aml05146  Amoebiasis
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05214  Glioma
aml05223  Non-small cell lung cancer
aml05225  Hepatocellular carcinoma
aml05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100477326 (PRKCA)
   04012 ErbB signaling pathway
    100477326 (PRKCA)
   04014 Ras signaling pathway
    100477326 (PRKCA)
   04015 Rap1 signaling pathway
    100477326 (PRKCA)
   04310 Wnt signaling pathway
    100477326 (PRKCA)
   04370 VEGF signaling pathway
    100477326 (PRKCA)
   04066 HIF-1 signaling pathway
    100477326 (PRKCA)
   04020 Calcium signaling pathway
    100477326 (PRKCA)
   04070 Phosphatidylinositol signaling system
    100477326 (PRKCA)
   04072 Phospholipase D signaling pathway
    100477326 (PRKCA)
   04071 Sphingolipid signaling pathway
    100477326 (PRKCA)
   04151 PI3K-Akt signaling pathway
    100477326 (PRKCA)
   04150 mTOR signaling pathway
    100477326 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100477326 (PRKCA)
   04540 Gap junction
    100477326 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100477326 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    100477326 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    100477326 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    100477326 (PRKCA)
   04670 Leukocyte transendothelial migration
    100477326 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    100477326 (PRKCA)
   04929 GnRH secretion
    100477326 (PRKCA)
   04912 GnRH signaling pathway
    100477326 (PRKCA)
   04921 Oxytocin signaling pathway
    100477326 (PRKCA)
   04926 Relaxin signaling pathway
    100477326 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    100477326 (PRKCA)
   04918 Thyroid hormone synthesis
    100477326 (PRKCA)
   04919 Thyroid hormone signaling pathway
    100477326 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    100477326 (PRKCA)
   04916 Melanogenesis
    100477326 (PRKCA)
   04925 Aldosterone synthesis and secretion
    100477326 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100477326 (PRKCA)
   04270 Vascular smooth muscle contraction
    100477326 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    100477326 (PRKCA)
   04971 Gastric acid secretion
    100477326 (PRKCA)
   04972 Pancreatic secretion
    100477326 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100477326 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100477326 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    100477326 (PRKCA)
   04727 GABAergic synapse
    100477326 (PRKCA)
   04725 Cholinergic synapse
    100477326 (PRKCA)
   04728 Dopaminergic synapse
    100477326 (PRKCA)
   04726 Serotonergic synapse
    100477326 (PRKCA)
   04720 Long-term potentiation
    100477326 (PRKCA)
   04730 Long-term depression
    100477326 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    100477326 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100477326 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    100477326 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100477326 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100477326 (PRKCA)
   05206 MicroRNAs in cancer
    100477326 (PRKCA)
   05205 Proteoglycans in cancer
    100477326 (PRKCA)
   05231 Choline metabolism in cancer
    100477326 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100477326 (PRKCA)
   05214 Glioma
    100477326 (PRKCA)
   05223 Non-small cell lung cancer
    100477326 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100477326 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    100477326 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    100477326 (PRKCA)
   05032 Morphine addiction
    100477326 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100477326 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100477326 (PRKCA)
   05161 Hepatitis B
    100477326 (PRKCA)
   05171 Coronavirus disease - COVID-19
    100477326 (PRKCA)
   05164 Influenza A
    100477326 (PRKCA)
   05163 Human cytomegalovirus infection
    100477326 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100477326 (PRKCA)
   05143 African trypanosomiasis
    100477326 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100477326 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100477326 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aml04131]
    100477326 (PRKCA)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100477326 (PRKCA)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100477326 (PRKCA)
Membrane trafficking [BR:aml04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100477326 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 APH
Other DBs
NCBI-GeneID: 100477326
NCBI-ProteinID: XP_002921765
Ensembl: ENSAMEG00000011747
UniProt: G1LZD5
LinkDB
Position
13
AA seq 672 aa
MADVFPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNVE
LRQKFEKAKLGPAGNKVISPSEDRRQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPGKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggctgacgttttcccggccaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcatgaggtgaaggaccacaaattcatc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggttcacaagaggtgccatgaa
tttgtcactttttcttgtccgggtgcggataagggacccgacaccgacgacccaagaagc
aagcacaagtttaaaatccacacttatggaagccccaccttctgtgatcactgtgggtcc
ttgctgtatggacttatccatcaagggatgaaatgtgacacctgcgacatgaacgtgcac
aaacagtgcgtgatcaacgtgcccagcctctgcgggatggaccacacggagaagaggggc
cggatctacctgaaggcggaggtcaccgacgagaagctccacgtcaccgtacgagatgca
aaaaatctaattcctatggatccaaatgggctttcagatccttatgtgaagctgaaactt
attcctgatcccaagaatgagagcaaacagaaaaccaaaaccatccgctccacactgaac
ccccagtggaatgagtcctttacattcaaattaaaaccttcggataaagaccgacggctg
tccgtagaaatctgggactgggatcgaacaactaggaatgatttcatggggtccctctcc
tttggagtctcggagctgatgaagatgccagccagcggatggtacaagctgcttaaccaa
gaggaaggtgagtactacaacgtgcccattccggaaggggacgaagaaggcaacgtggag
ctcaggcagaaattcgagaaagccaagcttggcccagctgggaacaaagtaatcagtcct
tcagaagacagaagacaaccttccaacaacctggacagagtgaaactcaccgacttcaat
ttcctcatggtgctggggaaggggagttttggaaaggtgatgcttgctgaccggaagggc
acagaggaactgtatgctatcaaaatcctgaagaaggatgtggtgattcaggatgacgac
gtggagtgcaccatggtggagaagcgagtcctagccctcctggacaagccgccgttcctg
acacagctacactcctgcttccagacagtggatcggctgtacttcgtcatggaatacgtc
aatggcggggacctcatgtaccacattcagcaagtaggaaaatttaaggaaccacaagca
gtattttatgcggcagagatttccattggattgttctttcttcataaaagaggaatcatt
tacagggatctgaagttagataatgtcatgctggattcagaagggcatatcaagattgcc
gattttgggatgtgcaaggaacacatgatggacggagtcacaaccaggaccttctgtggg
acgccagattacatcgccccagagataatcgcctatcagccgtatggaaaatctgtggac
tggtgggcctatggcgtcctgttgtatgaaatgctagctgggcagcctccctttgatggt
gaagatgaagacgagctgtttcagtccataatggagcataacgtttcttatcccaagtcc
ttgtccaaggaggccgtttccatctgcaagggactgatgaccaaacacccaggcaagcgg
ctgggttgcgggccggagggggagagggacgtgcgggaacatgccttcttccggaggatc
gactgggagaaactcgagaacagggagatccagccacccttcaagcccaaagtgtgtggc
aaaggcgcagaaaactttgacaagttcttcacgcgagggcagcctgtcttgacaccacct
gatcagctggtcattgctaacatagaccagtctgatttcgaggggttctcgtatgtcaac
ccccagtttgtgcaccccatcttacagagcgcagtatga

KEGG   Ailuropoda melanoleuca (giant panda): 100478007
Entry
100478007         CDS       T01329                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta type isoform X2
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04062  Chemokine signaling pathway
aml04064  NF-kappa B signaling pathway
aml04066  HIF-1 signaling pathway
aml04070  Phosphatidylinositol signaling system
aml04071  Sphingolipid signaling pathway
aml04150  mTOR signaling pathway
aml04270  Vascular smooth muscle contraction
aml04310  Wnt signaling pathway
aml04370  VEGF signaling pathway
aml04510  Focal adhesion
aml04540  Gap junction
aml04613  Neutrophil extracellular trap formation
aml04650  Natural killer cell mediated cytotoxicity
aml04662  B cell receptor signaling pathway
aml04666  Fc gamma R-mediated phagocytosis
aml04670  Leukocyte transendothelial migration
aml04713  Circadian entrainment
aml04720  Long-term potentiation
aml04723  Retrograde endocannabinoid signaling
aml04724  Glutamatergic synapse
aml04725  Cholinergic synapse
aml04726  Serotonergic synapse
aml04727  GABAergic synapse
aml04728  Dopaminergic synapse
aml04730  Long-term depression
aml04750  Inflammatory mediator regulation of TRP channels
aml04911  Insulin secretion
aml04912  GnRH signaling pathway
aml04916  Melanogenesis
aml04918  Thyroid hormone synthesis
aml04919  Thyroid hormone signaling pathway
aml04921  Oxytocin signaling pathway
aml04925  Aldosterone synthesis and secretion
aml04928  Parathyroid hormone synthesis, secretion and action
aml04929  GnRH secretion
aml04931  Insulin resistance
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04935  Growth hormone synthesis, secretion and action
aml04960  Aldosterone-regulated sodium reabsorption
aml04961  Endocrine and other factor-regulated calcium reabsorption
aml04970  Salivary secretion
aml04971  Gastric acid secretion
aml04972  Pancreatic secretion
aml04973  Carbohydrate digestion and absorption
aml05017  Spinocerebellar ataxia
aml05022  Pathways of neurodegeneration - multiple diseases
aml05031  Amphetamine addiction
aml05032  Morphine addiction
aml05140  Leishmaniasis
aml05143  African trypanosomiasis
aml05146  Amoebiasis
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05214  Glioma
aml05223  Non-small cell lung cancer
aml05225  Hepatocellular carcinoma
aml05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100478007 (PRKCB)
   04012 ErbB signaling pathway
    100478007 (PRKCB)
   04014 Ras signaling pathway
    100478007 (PRKCB)
   04015 Rap1 signaling pathway
    100478007 (PRKCB)
   04310 Wnt signaling pathway
    100478007 (PRKCB)
   04370 VEGF signaling pathway
    100478007 (PRKCB)
   04064 NF-kappa B signaling pathway
    100478007 (PRKCB)
   04066 HIF-1 signaling pathway
    100478007 (PRKCB)
   04020 Calcium signaling pathway
    100478007 (PRKCB)
   04070 Phosphatidylinositol signaling system
    100478007 (PRKCB)
   04071 Sphingolipid signaling pathway
    100478007 (PRKCB)
   04150 mTOR signaling pathway
    100478007 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100478007 (PRKCB)
   04540 Gap junction
    100478007 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100478007 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    100478007 (PRKCB)
   04662 B cell receptor signaling pathway
    100478007 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    100478007 (PRKCB)
   04670 Leukocyte transendothelial migration
    100478007 (PRKCB)
   04062 Chemokine signaling pathway
    100478007 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    100478007 (PRKCB)
   04929 GnRH secretion
    100478007 (PRKCB)
   04912 GnRH signaling pathway
    100478007 (PRKCB)
   04921 Oxytocin signaling pathway
    100478007 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    100478007 (PRKCB)
   04918 Thyroid hormone synthesis
    100478007 (PRKCB)
   04919 Thyroid hormone signaling pathway
    100478007 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    100478007 (PRKCB)
   04916 Melanogenesis
    100478007 (PRKCB)
   04925 Aldosterone synthesis and secretion
    100478007 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100478007 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    100478007 (PRKCB)
   04971 Gastric acid secretion
    100478007 (PRKCB)
   04972 Pancreatic secretion
    100478007 (PRKCB)
   04973 Carbohydrate digestion and absorption
    100478007 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100478007 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100478007 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    100478007 (PRKCB)
   04727 GABAergic synapse
    100478007 (PRKCB)
   04725 Cholinergic synapse
    100478007 (PRKCB)
   04728 Dopaminergic synapse
    100478007 (PRKCB)
   04726 Serotonergic synapse
    100478007 (PRKCB)
   04720 Long-term potentiation
    100478007 (PRKCB)
   04730 Long-term depression
    100478007 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    100478007 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100478007 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100478007 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100478007 (PRKCB)
   05206 MicroRNAs in cancer
    100478007 (PRKCB)
   05205 Proteoglycans in cancer
    100478007 (PRKCB)
   05231 Choline metabolism in cancer
    100478007 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100478007 (PRKCB)
   05214 Glioma
    100478007 (PRKCB)
   05223 Non-small cell lung cancer
    100478007 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100478007 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    100478007 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    100478007 (PRKCB)
   05032 Morphine addiction
    100478007 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100478007 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100478007 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100478007 (PRKCB)
   05161 Hepatitis B
    100478007 (PRKCB)
   05171 Coronavirus disease - COVID-19
    100478007 (PRKCB)
   05164 Influenza A
    100478007 (PRKCB)
   05163 Human cytomegalovirus infection
    100478007 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100478007 (PRKCB)
   05140 Leishmaniasis
    100478007 (PRKCB)
   05143 African trypanosomiasis
    100478007 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100478007 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100478007 (PRKCB)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100478007 (PRKCB)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100478007 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 100478007
NCBI-ProteinID: XP_011232297
Ensembl: ENSAMEG00000014177
LinkDB
Position
10
AA seq 671 aa
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIEREVLIVVVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGNEE
LRQKFERAKISQGTKAPEEKTTNTISKLDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGF
SYTNPEFVINV
NT seq 2016 nt   +upstreamnt  +downstreamnt
atggctgacccggctgcggggccgccgccgagcgagggcgaggagagcaccgtgcgcttc
gcccgcaaaggcgccctccgacagaagaacgtgcacgaggtgaagaaccacaaattcact
gcccgcttcttcaagcagcccacattctgcagccactgcaccgacttcatctggggcttc
ggaaagcaaggattccagtgccaagtctgctgttttgttgtgcacaagcggtgccatgaa
tttgtcaccttctcctgcccaggcgccgacaaaggcccagcctccgatgacccccggagc
aaacacaagtttaagatccacacgtactccagccccacgttttgtgaccactgtgggtca
ctgctgtatggactcatccaccaggggatgaagtgtgacacctgcatgatgaacgtgcac
aagcgctgcgtgatgaacgtccccagcctgtgcggcacagaccacacggagcgccgcggc
cgcatctacatccaggcccacatcgagagggaagtcctcattgtagtcgtaagagatgct
aaaaaccttgtacctatggaccccaatggcttgtcagacccttacgtgaaactaaaactg
attcctgaccccaagagcgagagcaagcagaagaccaaaaccatcaagtgctccctcaac
cctgagtggaatgagacattcagattccaactgaaagaatcggacaaagacagaagactg
tctgtagagatttgggattgggatctgaccagcaggaatgacttcatgggatctttgtcg
tttgggatttccgaactgcagaaagctggtgttgatggctggtttaagctgctgagccag
gaggaaggcgaatacttcaatgtgcctgtgccgccggaaggaagcgaaggcaatgaagag
ctgcggcagaaattcgagagggccaagatcagtcaggggaccaaggctccagaagaaaag
acgaccaacaccatatccaaacttgacaacaacgggaacagagaccgaatgaaactgacc
gattttaacttcctgatggtgctcgggaaaggaagctttggaaaggtcatgctctctgag
cgaaaaggcacggacgagctctatgccgtgaagatcctgaagaaggacgtcgtgatccag
gatgacgatgtggagtgcacgatggtggagaagcgggtgctggccctgcctgggaagccg
ccattcctgacccaactgcattcctgcttccagaccatggaccgcctgtactttgtgatg
gagtatgtgaacgggggcgacctcatgtaccacatccaacaagtcggccggtttaaggag
cctcatgctgtattttacgctgcagaaattgccatcggtctgttcttcttacagagcaag
ggcatcatttaccgtgacctcaaacttgacaatgtgatgctggattcagagggccacatc
aagattgctgattttggcatgtgcaaagaaaacatctgggatggggtgaccaccaagaca
ttctgtggcactccagactacatcgcccctgagatcattgcctaccagccctatgggaag
tctgtggattggtgggccttcggagtcctgctgtacgaaatgttggctgggcaggcaccc
tttgaaggggaggatgaggatgagctcttccagtccatcatggaacacaatgtggcttac
cccaagtccatgtccaaggaagctgtggccatctgcaaagggctgatgaccaaacacccg
ggcaaacgtctgggttgcggacccgaaggtgaacgtgacatcaaggagcatgcgtttttc
cggtatattgattgggagaaacttgaacgcaaagagattcagcccccgtataagccaaaa
gccagagacaagcgagacacctccaacttcgacaaagagttcaccagacagcctgtggaa
ctcacgcctaccgataaactcttcatcatgaacttggaccaaaatgaatttgctggcttc
tcctatactaacccagagtttgtcattaatgtgtag

KEGG   Ailuropoda melanoleuca (giant panda): 100484719
Entry
100484719         CDS       T01329                                 

Gene name
PRKCG
Definition
(RefSeq) protein kinase C gamma type isoform X1
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04015  Rap1 signaling pathway
aml04020  Calcium signaling pathway
aml04066  HIF-1 signaling pathway
aml04070  Phosphatidylinositol signaling system
aml04071  Sphingolipid signaling pathway
aml04150  mTOR signaling pathway
aml04270  Vascular smooth muscle contraction
aml04310  Wnt signaling pathway
aml04370  VEGF signaling pathway
aml04510  Focal adhesion
aml04540  Gap junction
aml04613  Neutrophil extracellular trap formation
aml04650  Natural killer cell mediated cytotoxicity
aml04666  Fc gamma R-mediated phagocytosis
aml04670  Leukocyte transendothelial migration
aml04713  Circadian entrainment
aml04720  Long-term potentiation
aml04723  Retrograde endocannabinoid signaling
aml04724  Glutamatergic synapse
aml04725  Cholinergic synapse
aml04726  Serotonergic synapse
aml04727  GABAergic synapse
aml04728  Dopaminergic synapse
aml04730  Long-term depression
aml04750  Inflammatory mediator regulation of TRP channels
aml04911  Insulin secretion
aml04916  Melanogenesis
aml04918  Thyroid hormone synthesis
aml04919  Thyroid hormone signaling pathway
aml04921  Oxytocin signaling pathway
aml04925  Aldosterone synthesis and secretion
aml04928  Parathyroid hormone synthesis, secretion and action
aml04929  GnRH secretion
aml04935  Growth hormone synthesis, secretion and action
aml04960  Aldosterone-regulated sodium reabsorption
aml04961  Endocrine and other factor-regulated calcium reabsorption
aml04970  Salivary secretion
aml04971  Gastric acid secretion
aml04972  Pancreatic secretion
aml05017  Spinocerebellar ataxia
aml05022  Pathways of neurodegeneration - multiple diseases
aml05031  Amphetamine addiction
aml05032  Morphine addiction
aml05143  African trypanosomiasis
aml05146  Amoebiasis
aml05161  Hepatitis B
aml05163  Human cytomegalovirus infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05206  MicroRNAs in cancer
aml05214  Glioma
aml05223  Non-small cell lung cancer
aml05225  Hepatocellular carcinoma
aml05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100484719 (PRKCG)
   04012 ErbB signaling pathway
    100484719 (PRKCG)
   04014 Ras signaling pathway
    100484719 (PRKCG)
   04015 Rap1 signaling pathway
    100484719 (PRKCG)
   04310 Wnt signaling pathway
    100484719 (PRKCG)
   04370 VEGF signaling pathway
    100484719 (PRKCG)
   04066 HIF-1 signaling pathway
    100484719 (PRKCG)
   04020 Calcium signaling pathway
    100484719 (PRKCG)
   04070 Phosphatidylinositol signaling system
    100484719 (PRKCG)
   04071 Sphingolipid signaling pathway
    100484719 (PRKCG)
   04150 mTOR signaling pathway
    100484719 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100484719 (PRKCG)
   04540 Gap junction
    100484719 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100484719 (PRKCG)
   04650 Natural killer cell mediated cytotoxicity
    100484719 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    100484719 (PRKCG)
   04670 Leukocyte transendothelial migration
    100484719 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    100484719 (PRKCG)
   04929 GnRH secretion
    100484719 (PRKCG)
   04921 Oxytocin signaling pathway
    100484719 (PRKCG)
   04935 Growth hormone synthesis, secretion and action
    100484719 (PRKCG)
   04918 Thyroid hormone synthesis
    100484719 (PRKCG)
   04919 Thyroid hormone signaling pathway
    100484719 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    100484719 (PRKCG)
   04916 Melanogenesis
    100484719 (PRKCG)
   04925 Aldosterone synthesis and secretion
    100484719 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100484719 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    100484719 (PRKCG)
   04971 Gastric acid secretion
    100484719 (PRKCG)
   04972 Pancreatic secretion
    100484719 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100484719 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    100484719 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    100484719 (PRKCG)
   04727 GABAergic synapse
    100484719 (PRKCG)
   04725 Cholinergic synapse
    100484719 (PRKCG)
   04728 Dopaminergic synapse
    100484719 (PRKCG)
   04726 Serotonergic synapse
    100484719 (PRKCG)
   04720 Long-term potentiation
    100484719 (PRKCG)
   04730 Long-term depression
    100484719 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    100484719 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100484719 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100484719 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100484719 (PRKCG)
   05206 MicroRNAs in cancer
    100484719 (PRKCG)
   05205 Proteoglycans in cancer
    100484719 (PRKCG)
   05231 Choline metabolism in cancer
    100484719 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100484719 (PRKCG)
   05214 Glioma
    100484719 (PRKCG)
   05223 Non-small cell lung cancer
    100484719 (PRKCG)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100484719 (PRKCG)
   05022 Pathways of neurodegeneration - multiple diseases
    100484719 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    100484719 (PRKCG)
   05032 Morphine addiction
    100484719 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100484719 (PRKCG)
   05161 Hepatitis B
    100484719 (PRKCG)
   05171 Coronavirus disease - COVID-19
    100484719 (PRKCG)
   05163 Human cytomegalovirus infection
    100484719 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100484719 (PRKCG)
   05143 African trypanosomiasis
    100484719 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100484719 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100484719 (PRKCG)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100484719 (PRKCG)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100484719 (PRKCG)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like
Other DBs
NCBI-GeneID: 100484719
NCBI-ProteinID: XP_002927999
Ensembl: ENSAMEG00000004418
UniProt: D2HYP8
LinkDB
Position
12
AA seq 697 aa
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHVTVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDSKRCFFGTSPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPAKRLGS
GPDGEPAIRAHGFFRWMDWERLERLEIAPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPISPPPVPVM
NT seq 2094 nt   +upstreamnt  +downstreamnt
atggcaggcctgggccccggcggaggcgattcagaggggggaccccggcccctgttttgc
agaaagggggctctgaggcagaaggtggtccacgaagtcaagagccacaagttcaccgcc
cgcttcttcaagcagccaaccttctgcagccactgcaccgacttcatctggggaattgga
aaacagggcctgcaatgtcaagtctgcagctttgtggttcatcgacgatgccacgaattt
gtgaccttcgagtgtccaggcgctgggaagggcccccagacggatgacccccggaacaag
cacaagttccgtctgcacagctacagcagccccaccttttgcgaccactgcggctccctc
ctctacgggctggtgcaccagggcatgaaatgctcctgctgcgagatgaacgtgcaccga
cgctgtgtgcgcagcgtgccctctctgtgcggggtggaccacaccgagcgccgtgggcgc
ctgcagctggaaatccgggcaccgacggcagatgagatacacgtcacagttggcgaggcc
cgtaacctcatcccgatggatcccaatggtctgtctgatccctatgtgaagctgaagctc
atcccagaccctcggaacttgacgaaacagaagacccgaacagtgaaagccacactaaac
cctgtgtggaacgagacctttgtgttcaacttgaagccgggggacgtggagcgccggctc
agcgtggaggtgtgggactgggaccggacttcccgcaatgatttcatgggtgccatgtcc
ttcggtgtctcggagctgctcaaggcgccggtggacggctggtacaagttactgaaccag
gaggagggcgagtattacaatgtgccggtggctgacgctgacaactgcagcctcctccag
aaatttgaggcctgtaactacccactggaactgtatgagcgggtgcggatgggtccctct
tcgtctcccatcccttccccatcccccagtcccaccgactccaagcgctgtttctttggg
acaagccctggacgtctgcacatctctgacttcagcttcctcatggttctaggaaaaggc
agttttgggaaggtgatgctggctgagcgcaggggctccgatgagctctacgccatcaag
atcctgaagaaagacgtgattgttcaggatgacgacgtggactgcaccctggtggagaag
cgagtgctggccctggggggccgaggcccgggcggccggccccactttctcacccagctg
cattcgaccttccagaccccggatcgcctgtattttgtgatggagtatgtcacggggggc
gacctgatgtaccacatccagcagttgggcaagtttaaggagccccatgcagcgttctac
gcagcggaaatcgccatcggcctcttcttccttcacaatcagggcatcatctaccgggac
ctgaaactagacaacgtgatgctggacgcagaaggacacatcaaaatcacggacttcggc
atgtgtaaggagaacgtcttccccgggaccacgacccgcaccttctgcgggaccccagac
tacatagcccctgagatcattgcctaccagccctatgggaagtctgtggattggtggtcc
tttggggttctgctgtatgagatgctggcaggacagcccccttttgacggggaggatgag
gaagagctgtttcaggccatcatggaacaaactgtcacttaccccaagtcactttcccgg
gaagccgtggcgatctgcaaggggttcctaactaagcacccagcgaagcgcctgggctcg
gggccagacggggagcccgccatccgtgctcatggctttttccgctggatggactgggag
cgcctggaacgactggagatcgcgcctccgttcagaccccgtccgtgtggacgcagcggt
gagaacttcgacaaattcttcacgcgggcggcgccagcgctgaccccgccagaccgccta
gtgttggccagcatcgaccaggccgatttccaaggcttcacctacgtgaacccggatttc
gtgcacccagatgcccgcagccccatcagccctccgcctgtgccagtcatgtaa

DBGET integrated database retrieval system