KEGG   Ailuropoda melanoleuca (giant panda): 100477592
Entry
100477592         CDS       T01329                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml05164  Influenza A
aml05171  Coronavirus disease - COVID-19
aml05202  Transcriptional misregulation in cancer
aml05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100477592 (TMPRSS2)
  09162 Cancer: specific types
   05215 Prostate cancer
    100477592 (TMPRSS2)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100477592 (TMPRSS2)
   05164 Influenza A
    100477592 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aml01002]
    100477592 (TMPRSS2)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100477592 (TMPRSS2)
Peptidases and inhibitors [BR:aml01002]
 Serine peptidases
  Family S1: chymotrypsin family
   100477592 (TMPRSS2)
SSDB
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR DUF1986 Trypsin_2 SRCR Ldl_recept_a
Other DBs
NCBI-GeneID: 100477592
NCBI-ProteinID: XP_034511296
Ensembl: ENSAMEG00000010563
LinkDB
Position
1
AA seq 492 aa
MALNSGSPPGDGPYYENHGYQPESLYPARPATVPSAYPVYPAPYYPPTVPQYTPRVPTHT
STPAVRVQPKSPLGTACTAKAKRALCITVALGAVLAGAAVAAVLLWRFMESKCSVSGIEC
SSSGTCISPSQWCDGVLHCPSGEDENRCVRLYGPDFILQVYSAQRKSWHPVCQDDWNDSY
GRAACQDMGYRNSFYSSHGVMDDSGATSFMKLNITASNMDLYKKLFHSDVCSSKMVVSLR
CIECGVTAKMRRQSRIVGGSSASEGDWPWQVSLHVQGTHVCGGSVITPEWIVTAAHCVEE
PLNSPRYWTAFAGILRQSFMFYGHGYRVGKVISHPNYDSKTKNNDIALMKLQTPLTFNDK
VKPVCLPNPGLMLEPDQSCWISGWGATHEKGKTSDKLNAAMVPLIEPQRCNSKYVYNNLV
TPAMVCAGYLQGSVDSCQGDSGGPLVTLKSRIWWLIGDTSWGSGCAKANRPGVYGNMTVF
TDWIYRQMRANS
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggctttaaactcagggtcaccgccaggagatggaccttactatgaaaaccacggatac
cagcctgaaagcctctatcccgcgcggcccgccacggtcccgagcgcctacccggtgtat
ccggccccgtactacccgcccacggtgccccagtacaccccgagggtgccgacgcacact
tcgacacctgccgtccgcgtgcagcccaagtccccgttggggactgcatgcactgcaaag
gccaagagagccctgtgcatcaccgtcgccctgggggccgtgctggcgggagccgccgtg
gctgctgtcctgctctggaggttcatggagagcaaatgctcagtgtccgggatagagtgc
agctcctcgggaacctgcatcagcccctctcagtggtgcgacggggtcctgcactgcccc
agcggtgaggacgagaaccgatgcgttcgcctctacggcccggacttcatcctccaggtg
tactcggcccagaggaagtcctggcaccccgtgtgtcaggatgactggaatgacagctac
gggagggccgcgtgccaggacatgggctaccggaatagcttttattctagccacggagtt
atggatgacagcggggccaccagctttatgaagctgaatataactgctagcaatatggac
ctctataagaaattattccacagcgacgtctgttcttcgaaaatggtggtttctttacgc
tgtatcgagtgcggggtcacggcgaagatgaggcgccagagccggatcgtgggcgggagc
agcgcctccgaaggggactggccctggcaggtcagcctgcacgtccagggcacccacgtc
tgcggaggctctgttatcacccccgaatggatcgtgacagccgcccactgtgtggaggaa
cccctaaacagcccccggtattggacggccttcgcaggaatcctgagacaatctttcatg
ttctacggacatggataccgagtgggaaaagtgatttcacatcccaattacgattccaag
accaagaacaatgacatcgctcttatgaagttgcaaacacctctgactttcaacgacaaa
gtgaaaccagtgtgtctgcccaacccaggcctgatgctagagccggatcagtcctgctgg
atttccgggtggggggccacccacgagaaagggaagacctcggacaagctgaatgcggcc
atggtacccctcatcgagccccagcgctgcaacagcaagtacgtctacaacaacctggtc
acgccagccatggtctgcgcaggctacctgcaggggagcgtcgactcctgccagggtgac
agcggagggcccctggtcactttgaagagccgcatctggtggctgattggggacacgagc
tggggatccggctgtgccaaagccaacagaccaggagtgtacggaaacatgacagtgttt
acggactggatttaccgacagatgagggcaaacagctaa

DBGET integrated database retrieval system