KEGG   Ailuropoda melanoleuca (giant panda): 100477600
Entry
100477600         CDS       T01329                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X2
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01522  Endocrine resistance
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04024  cAMP signaling pathway
aml04068  FoxO signaling pathway
aml04071  Sphingolipid signaling pathway
aml04137  Mitophagy - animal
aml04140  Autophagy - animal
aml04141  Protein processing in endoplasmic reticulum
aml04210  Apoptosis
aml04215  Apoptosis - multiple species
aml04217  Necroptosis
aml04310  Wnt signaling pathway
aml04380  Osteoclast differentiation
aml04510  Focal adhesion
aml04530  Tight junction
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04622  RIG-I-like receptor signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04657  IL-17 signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04668  TNF signaling pathway
aml04722  Neurotrophin signaling pathway
aml04723  Retrograde endocannabinoid signaling
aml04728  Dopaminergic synapse
aml04750  Inflammatory mediator regulation of TRP channels
aml04910  Insulin signaling pathway
aml04912  GnRH signaling pathway
aml04914  Progesterone-mediated oocyte maturation
aml04917  Prolactin signaling pathway
aml04920  Adipocytokine signaling pathway
aml04926  Relaxin signaling pathway
aml04930  Type II diabetes mellitus
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04935  Growth hormone synthesis, secretion and action
aml05010  Alzheimer disease
aml05012  Parkinson disease
aml05016  Huntington disease
aml05017  Spinocerebellar ataxia
aml05020  Prion disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05132  Salmonella infection
aml05133  Pertussis
aml05135  Yersinia infection
aml05142  Chagas disease
aml05145  Toxoplasmosis
aml05152  Tuberculosis
aml05161  Hepatitis B
aml05162  Measles
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05210  Colorectal cancer
aml05212  Pancreatic cancer
aml05231  Choline metabolism in cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100477600 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100477600 (MAPK9)
   04012 ErbB signaling pathway
    100477600 (MAPK9)
   04014 Ras signaling pathway
    100477600 (MAPK9)
   04310 Wnt signaling pathway
    100477600 (MAPK9)
   04668 TNF signaling pathway
    100477600 (MAPK9)
   04068 FoxO signaling pathway
    100477600 (MAPK9)
   04071 Sphingolipid signaling pathway
    100477600 (MAPK9)
   04024 cAMP signaling pathway
    100477600 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100477600 (MAPK9)
   04137 Mitophagy - animal
    100477600 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    100477600 (MAPK9)
   04215 Apoptosis - multiple species
    100477600 (MAPK9)
   04217 Necroptosis
    100477600 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100477600 (MAPK9)
   04530 Tight junction
    100477600 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100477600 (MAPK9)
   04621 NOD-like receptor signaling pathway
    100477600 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    100477600 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    100477600 (MAPK9)
   04660 T cell receptor signaling pathway
    100477600 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    100477600 (MAPK9)
   04659 Th17 cell differentiation
    100477600 (MAPK9)
   04657 IL-17 signaling pathway
    100477600 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    100477600 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100477600 (MAPK9)
   04920 Adipocytokine signaling pathway
    100477600 (MAPK9)
   04912 GnRH signaling pathway
    100477600 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    100477600 (MAPK9)
   04917 Prolactin signaling pathway
    100477600 (MAPK9)
   04926 Relaxin signaling pathway
    100477600 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    100477600 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    100477600 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    100477600 (MAPK9)
   04722 Neurotrophin signaling pathway
    100477600 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100477600 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100477600 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100477600 (MAPK9)
   05231 Choline metabolism in cancer
    100477600 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100477600 (MAPK9)
   05212 Pancreatic cancer
    100477600 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100477600 (MAPK9)
   05012 Parkinson disease
    100477600 (MAPK9)
   05016 Huntington disease
    100477600 (MAPK9)
   05017 Spinocerebellar ataxia
    100477600 (MAPK9)
   05020 Prion disease
    100477600 (MAPK9)
   05022 Pathways of neurodegeneration - multiple diseases
    100477600 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100477600 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100477600 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    100477600 (MAPK9)
   04931 Insulin resistance
    100477600 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100477600 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100477600 (MAPK9)
   05135 Yersinia infection
    100477600 (MAPK9)
   05133 Pertussis
    100477600 (MAPK9)
   05152 Tuberculosis
    100477600 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100477600 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    100477600 (MAPK9)
   05161 Hepatitis B
    100477600 (MAPK9)
   05171 Coronavirus disease - COVID-19
    100477600 (MAPK9)
   05162 Measles
    100477600 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100477600 (MAPK9)
   05169 Epstein-Barr virus infection
    100477600 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100477600 (MAPK9)
   05142 Chagas disease
    100477600 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100477600 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100477600 (MAPK9)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100477600 (MAPK9)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100477600 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like APH RIO1 FTA2
Other DBs
NCBI-GeneID: 100477600
NCBI-ProteinID: XP_002927830
Ensembl: ENSAMEG00000000853
LinkDB
Position
3
AA seq 424 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMAEMVLHKVLFPGRDYIDQWNKVIEQ
LGTPLADFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
LDWEERSKNGVVKDQPSDAAVSSNATPSRSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaatgtgacagtcagttttacagtgtacaagtggcagactcaaccttc
acggtcctaaaacgttaccagcagttgaagccaatcggctccggagcccaaggaatagtt
tgtgctgcttttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaatcaaactcatgcaaagagagcttaccgtgaactcgtcctcttaaaatgtgtc
aatcataaaaatataattagtttattaaatgtgtttacaccacagaagaccctagaagaa
tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcac
atggagttggaccatgaaagaatgtcctaccttctttaccaaatgctctgtggtattaaa
catctgcattcagctggtatcattcatagagacttgaaaccgagcaacatcgtggtaaaa
tcagactgcacgcttaagatccttgactttggcctggcccggacagcatgcaccaacttc
atgatgacgccgtacgtggtgacgcgctattaccgggcgcccgaagtcatcctgggcatg
ggctacaaagagaacgtggacatctggtctgtcgggtgcatcatggcagaaatggtcctc
cataaagtcctgttcccaggaagagactatattgatcagtggaataaagtcattgagcag
ctgggaacgccgttggcggattttatgaagaaacttcagccgaccgtgaggaattatgta
gaaaacagaccgaagtaccccggcatcaaatttgaagagctcttcccagattggatattc
ccatcagaatccgagcgagacaaaattaaaacaagtcaagccagagatttgttatcgaaa
atgttagtgatagatcccgacaagcgaatctctgtagacgaagctttacgtcacccttac
attaccgtttggtatgaccctgctgaagccgaggcgccaccacctcagatttacgacgcc
cagctagaagaaagagagcatgcaattgaagagtggaaagagctgatttacaaagaagtg
ctggattgggaagaacgaagcaagaacggtgtggtcaaagatcagccttcagatgcagca
gtaagtagcaacgccactccttcccggtcgtcgtccatcaacgacatctcgtccatgtcc
actgagcagacgctggcctcagacacagacagcagcctcgacgcctcgacgggacccctc
gaaggttgccgatga

KEGG   Ailuropoda melanoleuca (giant panda): 100477951
Entry
100477951         CDS       T01329                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01522  Endocrine resistance
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04024  cAMP signaling pathway
aml04068  FoxO signaling pathway
aml04071  Sphingolipid signaling pathway
aml04137  Mitophagy - animal
aml04140  Autophagy - animal
aml04141  Protein processing in endoplasmic reticulum
aml04210  Apoptosis
aml04215  Apoptosis - multiple species
aml04217  Necroptosis
aml04310  Wnt signaling pathway
aml04380  Osteoclast differentiation
aml04510  Focal adhesion
aml04530  Tight junction
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04622  RIG-I-like receptor signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04657  IL-17 signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04668  TNF signaling pathway
aml04722  Neurotrophin signaling pathway
aml04723  Retrograde endocannabinoid signaling
aml04728  Dopaminergic synapse
aml04750  Inflammatory mediator regulation of TRP channels
aml04910  Insulin signaling pathway
aml04912  GnRH signaling pathway
aml04914  Progesterone-mediated oocyte maturation
aml04917  Prolactin signaling pathway
aml04920  Adipocytokine signaling pathway
aml04926  Relaxin signaling pathway
aml04930  Type II diabetes mellitus
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04935  Growth hormone synthesis, secretion and action
aml05010  Alzheimer disease
aml05012  Parkinson disease
aml05016  Huntington disease
aml05017  Spinocerebellar ataxia
aml05020  Prion disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05132  Salmonella infection
aml05133  Pertussis
aml05135  Yersinia infection
aml05142  Chagas disease
aml05145  Toxoplasmosis
aml05152  Tuberculosis
aml05161  Hepatitis B
aml05162  Measles
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05210  Colorectal cancer
aml05212  Pancreatic cancer
aml05231  Choline metabolism in cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100477951 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100477951 (MAPK10)
   04012 ErbB signaling pathway
    100477951 (MAPK10)
   04014 Ras signaling pathway
    100477951 (MAPK10)
   04310 Wnt signaling pathway
    100477951 (MAPK10)
   04668 TNF signaling pathway
    100477951 (MAPK10)
   04068 FoxO signaling pathway
    100477951 (MAPK10)
   04071 Sphingolipid signaling pathway
    100477951 (MAPK10)
   04024 cAMP signaling pathway
    100477951 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100477951 (MAPK10)
   04137 Mitophagy - animal
    100477951 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    100477951 (MAPK10)
   04215 Apoptosis - multiple species
    100477951 (MAPK10)
   04217 Necroptosis
    100477951 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100477951 (MAPK10)
   04530 Tight junction
    100477951 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100477951 (MAPK10)
   04621 NOD-like receptor signaling pathway
    100477951 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    100477951 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    100477951 (MAPK10)
   04660 T cell receptor signaling pathway
    100477951 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    100477951 (MAPK10)
   04659 Th17 cell differentiation
    100477951 (MAPK10)
   04657 IL-17 signaling pathway
    100477951 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    100477951 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100477951 (MAPK10)
   04920 Adipocytokine signaling pathway
    100477951 (MAPK10)
   04912 GnRH signaling pathway
    100477951 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    100477951 (MAPK10)
   04917 Prolactin signaling pathway
    100477951 (MAPK10)
   04926 Relaxin signaling pathway
    100477951 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    100477951 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    100477951 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    100477951 (MAPK10)
   04722 Neurotrophin signaling pathway
    100477951 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100477951 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100477951 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100477951 (MAPK10)
   05231 Choline metabolism in cancer
    100477951 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100477951 (MAPK10)
   05212 Pancreatic cancer
    100477951 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100477951 (MAPK10)
   05012 Parkinson disease
    100477951 (MAPK10)
   05016 Huntington disease
    100477951 (MAPK10)
   05017 Spinocerebellar ataxia
    100477951 (MAPK10)
   05020 Prion disease
    100477951 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    100477951 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100477951 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100477951 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    100477951 (MAPK10)
   04931 Insulin resistance
    100477951 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100477951 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100477951 (MAPK10)
   05135 Yersinia infection
    100477951 (MAPK10)
   05133 Pertussis
    100477951 (MAPK10)
   05152 Tuberculosis
    100477951 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100477951 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    100477951 (MAPK10)
   05161 Hepatitis B
    100477951 (MAPK10)
   05171 Coronavirus disease - COVID-19
    100477951 (MAPK10)
   05162 Measles
    100477951 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100477951 (MAPK10)
   05169 Epstein-Barr virus infection
    100477951 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100477951 (MAPK10)
   05142 Chagas disease
    100477951 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100477951 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100477951 (MAPK10)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100477951 (MAPK10)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100477951 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 100477951
NCBI-ProteinID: XP_019661813
Ensembl: ENSAMEG00000003514
UniProt: G1LA16
LinkDB
Position
11
AA seq 464 aa
MSLHLLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagcctccatttattgtactactgcagtgaaccaaccttggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccaattctacagtgtggaagtgggagactcaaccttcacagtt
cttaagcgctaccagaatttgaagcctattggctctggggctcagggaatagtttgtgct
gcgtacgatgctgttcttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacgcatgccaagagagcttaccgggagctggtcctcatgaagtgtgtgaaccat
aaaaacattattagtttattaaatgtcttcacaccccagaaaacattggaggagttccaa
gatgtttacttagtaatggaactgatggatgccaacttgtgtcaggtgattcagatggaa
ttagaccacgagcgaatgtcttacctgctgtaccaaatgttgtgtggcatcaagcacctt
cactctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaagtctgat
tgtacattgaaaatcctcgactttggactggccaggacggcaggcacaagcttcatgatg
actccttatgtggttacacgttattatagagcccccgaggttattctgggaatgggctac
aaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa
atcctctttccaggaagggactatattgaccagtggaacaaggtaattgaacaactagga
acaccatgtccggaattcatgaagaaattgcaacctacagtaagaaactatgtggagaat
cggcccaagtatgcaggactcaccttccccaagctctttccagattccctcttcccagcg
gactctgagcacaataaactcaaagccagccaagccagggacttactgtcaaagatgcta
gtgattgacccagcaaaaaggatatcagtggatgacgccttacagcacccttacatcaat
gtgtggtacgaccctgccgaagtggaagcgcctccacctcagatttatgacaaacagttg
gatgaaagagaacacaccattgaagaatggaaagaacttatctacaaggaagtaatgaat
tcggaagaaaagactaaaaacggtgttgtaaaaggacaaccttctccttcaggtgcagca
gtgaacagcagtgagagtctccctccgtcttcgtctgtcaacgacatctcctccatgtcc
actgaccagaccctggcatccgacactgacagcagcctggaagcctcagcaggacccctg
ggttgttgcaggtga

KEGG   Ailuropoda melanoleuca (giant panda): 100482196
Entry
100482196         CDS       T01329                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01522  Endocrine resistance
aml04010  MAPK signaling pathway
aml04012  ErbB signaling pathway
aml04014  Ras signaling pathway
aml04024  cAMP signaling pathway
aml04068  FoxO signaling pathway
aml04071  Sphingolipid signaling pathway
aml04137  Mitophagy - animal
aml04140  Autophagy - animal
aml04141  Protein processing in endoplasmic reticulum
aml04210  Apoptosis
aml04215  Apoptosis - multiple species
aml04217  Necroptosis
aml04310  Wnt signaling pathway
aml04380  Osteoclast differentiation
aml04510  Focal adhesion
aml04530  Tight junction
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04622  RIG-I-like receptor signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04657  IL-17 signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04664  Fc epsilon RI signaling pathway
aml04668  TNF signaling pathway
aml04722  Neurotrophin signaling pathway
aml04723  Retrograde endocannabinoid signaling
aml04728  Dopaminergic synapse
aml04750  Inflammatory mediator regulation of TRP channels
aml04910  Insulin signaling pathway
aml04912  GnRH signaling pathway
aml04914  Progesterone-mediated oocyte maturation
aml04917  Prolactin signaling pathway
aml04920  Adipocytokine signaling pathway
aml04926  Relaxin signaling pathway
aml04930  Type II diabetes mellitus
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml04935  Growth hormone synthesis, secretion and action
aml05010  Alzheimer disease
aml05012  Parkinson disease
aml05016  Huntington disease
aml05017  Spinocerebellar ataxia
aml05020  Prion disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05132  Salmonella infection
aml05133  Pertussis
aml05135  Yersinia infection
aml05142  Chagas disease
aml05145  Toxoplasmosis
aml05152  Tuberculosis
aml05161  Hepatitis B
aml05162  Measles
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05200  Pathways in cancer
aml05210  Colorectal cancer
aml05212  Pancreatic cancer
aml05231  Choline metabolism in cancer
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100482196 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100482196 (MAPK8)
   04012 ErbB signaling pathway
    100482196 (MAPK8)
   04014 Ras signaling pathway
    100482196 (MAPK8)
   04310 Wnt signaling pathway
    100482196 (MAPK8)
   04668 TNF signaling pathway
    100482196 (MAPK8)
   04068 FoxO signaling pathway
    100482196 (MAPK8)
   04071 Sphingolipid signaling pathway
    100482196 (MAPK8)
   04024 cAMP signaling pathway
    100482196 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100482196 (MAPK8)
   04137 Mitophagy - animal
    100482196 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    100482196 (MAPK8)
   04215 Apoptosis - multiple species
    100482196 (MAPK8)
   04217 Necroptosis
    100482196 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100482196 (MAPK8)
   04530 Tight junction
    100482196 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100482196 (MAPK8)
   04621 NOD-like receptor signaling pathway
    100482196 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    100482196 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    100482196 (MAPK8)
   04660 T cell receptor signaling pathway
    100482196 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    100482196 (MAPK8)
   04659 Th17 cell differentiation
    100482196 (MAPK8)
   04657 IL-17 signaling pathway
    100482196 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    100482196 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100482196 (MAPK8)
   04920 Adipocytokine signaling pathway
    100482196 (MAPK8)
   04912 GnRH signaling pathway
    100482196 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    100482196 (MAPK8)
   04917 Prolactin signaling pathway
    100482196 (MAPK8)
   04926 Relaxin signaling pathway
    100482196 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    100482196 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    100482196 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    100482196 (MAPK8)
   04722 Neurotrophin signaling pathway
    100482196 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100482196 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100482196 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100482196 (MAPK8)
   05231 Choline metabolism in cancer
    100482196 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100482196 (MAPK8)
   05212 Pancreatic cancer
    100482196 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100482196 (MAPK8)
   05012 Parkinson disease
    100482196 (MAPK8)
   05016 Huntington disease
    100482196 (MAPK8)
   05017 Spinocerebellar ataxia
    100482196 (MAPK8)
   05020 Prion disease
    100482196 (MAPK8)
   05022 Pathways of neurodegeneration - multiple diseases
    100482196 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100482196 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100482196 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    100482196 (MAPK8)
   04931 Insulin resistance
    100482196 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100482196 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100482196 (MAPK8)
   05135 Yersinia infection
    100482196 (MAPK8)
   05133 Pertussis
    100482196 (MAPK8)
   05152 Tuberculosis
    100482196 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100482196 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    100482196 (MAPK8)
   05161 Hepatitis B
    100482196 (MAPK8)
   05171 Coronavirus disease - COVID-19
    100482196 (MAPK8)
   05162 Measles
    100482196 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100482196 (MAPK8)
   05169 Epstein-Barr virus infection
    100482196 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100482196 (MAPK8)
   05142 Chagas disease
    100482196 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100482196 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100482196 (MAPK8)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100482196 (MAPK8)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100482196 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530
Other DBs
NCBI-GeneID: 100482196
NCBI-ProteinID: XP_034518729
Ensembl: ENSAMEG00000017017
LinkDB
Position
6
AA seq 435 aa
MSRSKRDSNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELLFPSF
SELIYKEVMDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDT
DSSLEASAGPLGCCR
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgtgacagcaatttttatagtgtagagattggagattctacattt
acagtcttgaaacggtatcagaatttaaaacctataggctcaggagctcaaggaatagta
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccggcca
tttcagaatcagactcatgctaaacgggcttacagagagctagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggaactagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcccagtaatatagtggtaaaa
tcagactgcactttgaagattcttgactttggactggccaggaccgcaggaactagtttt
atgatgacaccttacgtagtgactcgctactacagagcacctgaggtcatcctagggatg
ggctacaaagaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgccctgaattcatgaagaaactacagccaacagtaaggacttatgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccccgatgtacttttc
ccagctgactcggaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa
atgctggtaattgatgcatctaaaaggatctctgtagatgaagctctccagcacccgtat
atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatacctgataag
cagttagatgaaagggaacatacaatagaagaatggaaagagttgttgttcccttctttt
tcagagttgatatacaaagaagttatggacttggaggagagaaccaagaatggagttata
cgggggcagccctctcctttaggtgcagcagtgatcaatggctctcagcatccatcgtca
tcatcgtctgtcaatgatgtgtcttcaatgtcaacagatccaactttggcctcagataca
gacagcagtctagaagcatcagctggacctctgggctgctgtagatga

DBGET integrated database retrieval system