KEGG   Ailuropoda melanoleuca (giant panda): 100477604
Entry
100477604         CDS       T01329                                 

Gene name
ERG
Definition
(RefSeq) transcriptional regulator ERG isoform X1
  KO
K09435  transcriptional regulator ERG
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml05202  Transcriptional misregulation in cancer
aml05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100477604 (ERG)
  09162 Cancer: specific types
   05215 Prostate cancer
    100477604 (ERG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100477604 (ERG)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    100477604 (ERG)
SSDB
Motif
Pfam: Ets SAM_PNT SAM_3 SAM_2 SAM_1
Other DBs
NCBI-GeneID: 100477604
NCBI-ProteinID: XP_011235089
Ensembl: ENSAMEG00000016610
LinkDB
Position
1
AA seq 479 aa
MASTIKEALSVVSEDQSLFECAYGTPHLAKTDMTASSSGDYGQTSKMSPRVPQQDWLSQP
PARVTIKMECNPNQVNGSRNSPDECSMAKGGKMVGSPDTVGMNFGSYMEEKHMPPPNMTT
NERRVIVPADPTLWSTDHVRQWLEWAVKEYGLPDVDILLFQNIDGKELCKMTKDDFQRLT
PSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVYPET
TQRITTRPDLPYDPPRRSAWTSHGHPTPQSKAAQPSPSAVPKTEDQRPQLDPYQILGPTS
SRLANPGSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMTDPDEVARRWGERKSKPNM
NYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGS
YHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPASHMPSHLGTYY
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggccagcactattaaggaagcgttatcggttgtgagcgaggaccagtcattgtttgag
tgtgcctacgggacgccacacctggctaagacggacatgaccgcgtcctcctccggcgac
tatggacagacatccaagatgagcccacgcgtccctcagcaggactggctgtctcaaccc
ccagccagggtcaccatcaagatggaatgtaaccctaaccaggtgaacggctccaggaac
tccccggatgaatgcagcatggcaaaaggcgggaagatggtgggcagtccagacactgtg
ggcatgaattttggcagctacatggaggagaagcacatgccacccccgaacatgaccacg
aacgaacgcagagtcatcgtgccagcagatcctacgctgtggagtacggaccacgtccgg
cagtggctggagtgggcagtgaaagaatatggccttccggacgtcgatatcttgctgttc
cagaacatcgacgggaaggagctgtgcaagatgaccaaggacgacttccagaggctcacc
ccgagctacaacgctgacatccttctctcgcacctgcactacctcagagagactcctctt
ccacatttgacttcagatgatgttgataaagccttacaaaactctccacggttaatgcat
gctagaaacacagggggtgcagcttttatattcccaaatacttcagtatatcctgaaact
acgcaaagaattacaactaggccagatttaccttacgacccacccaggagatcagcctgg
actagtcacggccaccccaccccccagtcgaaagctgctcaaccgtctccttctgcagtg
cccaaaaccgaagaccagcgtcctcagctagacccttatcagattcttggaccaacaagt
agccgccttgcaaacccagggagtggacagattcagctttggcagttcctcctggagctc
ctgtcggatagctcgaactccaactgcatcacctgggaaggcaccaatggggaattcaag
atgaccgatcccgatgaggtcgcccggcgctggggagagcggaaaagcaagcccaatatg
aactatgataaactcagccgcgccctccgttactactatgacaaaaatatcatgaccaaa
gttcacgggaagcgctatgcctacaagtttgacttccatgggattgcccaggccctgcag
ccccaccctccagaatcatctctgtacaagtacccctcggacctcccttacatgggctcc
tatcacgcccaccctcagaagatgaactttgtggccccccaccctcctgccctccccgtg
acatcatccagttttttcgccgccccaaacccctactggaattcgccaactggaggtata
taccccaacacgaggcttccggccagccatatgccctctcatctgggcacttactactag

DBGET integrated database retrieval system