KEGG   Ailuropoda melanoleuca (giant panda): 100477725
Entry
100477725         CDS       T01329                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1 isoform X1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04110  Cell cycle
aml04213  Longevity regulating pathway - multiple species
aml04330  Notch signaling pathway
aml04613  Neutrophil extracellular trap formation
aml04919  Thyroid hormone signaling pathway
aml05016  Huntington disease
aml05031  Amphetamine addiction
aml05034  Alcoholism
aml05165  Human papillomavirus infection
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05203  Viral carcinogenesis
aml05206  MicroRNAs in cancer
aml05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100477725 (HDAC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100477725 (HDAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100477725 (HDAC1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100477725 (HDAC1)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100477725 (HDAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100477725 (HDAC1)
   05202 Transcriptional misregulation in cancer
    100477725 (HDAC1)
   05206 MicroRNAs in cancer
    100477725 (HDAC1)
   05203 Viral carcinogenesis
    100477725 (HDAC1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100477725 (HDAC1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100477725 (HDAC1)
  09165 Substance dependence
   05031 Amphetamine addiction
    100477725 (HDAC1)
   05034 Alcoholism
    100477725 (HDAC1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100477725 (HDAC1)
   05165 Human papillomavirus infection
    100477725 (HDAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aml03036]
    100477725 (HDAC1)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100477725 (HDAC1)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100477725 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     100477725 (HDAC1)
    BRAF-HDAC complex
     100477725 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100477725 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    100477725 (HDAC1)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 100477725
NCBI-ProteinID: XP_002921911
Ensembl: ENSAMEG00000007608
LinkDB
Position
2
AA seq 482 aa
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVISKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQVIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNASNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKQEAKGVKEEVK
LA
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggcgcagactcagggcactaggaggaaagtctgttactactacgacggggatgttgga
aattactactatggacaaggccacccaatgaagcctcaccgaatccgcatgactcacaat
ttgctacttaactatggtctctaccgaaaaatggaaatctatcgccctcacaaagccaat
gctgaggagatgaccaagtaccacagtgacgactacattaaattcctgcgctccatccgc
ccagataacatgtccgagtacagcaagcagatgcagagattcaacgtcggtgaggactgt
ccagtatttgatggcctgtttgaattctgtcagttatctactggaggctctgtggcgagt
gctgtgaaactgaataagcagcagacggacatcgctgtgaattgggccgggggcctgcac
catgcaaagaagtctgaggcatccggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcaccacggc
gatggcgtggaagaggccttctataccacagaccgggtcatgactgtgtcctttcataaa
tacggagagtacttcccaggaactggggacctacgggacattggggctggcaaaggcaag
tattacgctgttaactacccgctccgagatgggatcgatgacgagtcctatgaggccatt
ttcaagccggtcatatctaaagtgatggagatgttccagcccagtgcggttgtcttacag
tgtggctctgactccctgtctggggatcggttaggttgcttcaatctgaccatcaaaggg
catgccaagtgtgtggagtttgtgaagagcttcaacctgcctatgctaatgctgggcgga
ggtggctacaccatccgtaacgtggcccgctgctggacgtacgaaacggcagtggccctg
gacacagaaatcccaaatgagcttccgtacaacgactacttcgaatactttgggccagat
ttcaaacttcacatcagtccttccaatatgaccaaccagaataccaatgaatacctggag
aagatcaaacagcgactgtttgagaacctgagaatgctgccccacgcacctggggtccaa
atgcaggtgattcctgaggatgccattccagaggagagtggcgacgaggacgaagaagac
cctgacaagcgcatctcgatctgttcttctgacaagcgaattgcatgtgaggaagagttc
tcagactctgatgaggagggagaaggtggacgcaagaacgcttccaacttcaaaaaagcc
aagagagtcaaaactgaggacgaaaaagagaaagacccagaagagaagaaagaagtcaca
gaagaggagaaaaccaaggaggagaagcaagaagccaaaggggtcaaggaggaggtcaag
ttggcttga

KEGG   Ailuropoda melanoleuca (giant panda): 100478424
Entry
100478424         CDS       T01329                                 

Gene name
HDAC2
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04110  Cell cycle
aml04213  Longevity regulating pathway - multiple species
aml04330  Notch signaling pathway
aml04613  Neutrophil extracellular trap formation
aml04919  Thyroid hormone signaling pathway
aml05016  Huntington disease
aml05031  Amphetamine addiction
aml05034  Alcoholism
aml05165  Human papillomavirus infection
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05203  Viral carcinogenesis
aml05206  MicroRNAs in cancer
aml05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100478424 (HDAC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100478424 (HDAC2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100478424 (HDAC2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100478424 (HDAC2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100478424 (HDAC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100478424 (HDAC2)
   05202 Transcriptional misregulation in cancer
    100478424 (HDAC2)
   05206 MicroRNAs in cancer
    100478424 (HDAC2)
   05203 Viral carcinogenesis
    100478424 (HDAC2)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100478424 (HDAC2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100478424 (HDAC2)
  09165 Substance dependence
   05031 Amphetamine addiction
    100478424 (HDAC2)
   05034 Alcoholism
    100478424 (HDAC2)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100478424 (HDAC2)
   05165 Human papillomavirus infection
    100478424 (HDAC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aml03036]
    100478424 (HDAC2)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100478424 (HDAC2)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     100478424 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     100478424 (HDAC2)
    BRAF-HDAC complex
     100478424 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100478424 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    100478424 (HDAC2)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 100478424
NCBI-ProteinID: XP_002922834
Ensembl: ENSAMEG00000013147
LinkDB
Position
10
AA seq 488 aa
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKADVKEEDKSKDSSGEKTDTKGA
KSEQLSNP
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggcgtacagtcagggaggcggcaagaagaaagtctgctactactacgatggtgatatt
ggaaattactattatggacagggtcatcccatgaaacctcatagaatccgcatgacccat
aacttgctgctaaattatggcttatatagaaaaatggaaatatataggccccataaagcc
actgctgaagaaatgacaaaataccacagtgatgagtacatcaaatttctacgttcaata
agaccagataacatgtctgagtatagtaagcagatgcagagatttaatgttggagaagat
tgtccagtgtttgatggactctttgagttttgtcagctctcaactggtggctcggttgct
ggggctgtgaagttaaaccgacaacaaactgatatggctgttaactgggctggaggatta
catcacgctaagaaatcagaagcatcaggattctgttacgttaatgatattgtacttgct
atccttgaattactaaagtatcaccagagagtcttatatattgatattgatatccatcat
ggtgatggtgttgaagaagctttttatacaacagatcgtgtaatgactgtatcattccat
aaatatggggaatactttcctggaacaggagacttgagggatattggtgcaggaaaaggc
aaatactatgctgtcaattttccaatgagagatggtatagatgatgaatcctatgggcag
atatttaagcctattatctcaaaggtgatggaaatgtaccagcccagtgctgtggtgctc
cagtgtggtgcggactcactatctggtgacaggctcgggtgcttcaatctgacagtcaaa
ggtcatgctaaatgtgtagaagttgtgaaaactttcaatttaccattactgatgcttggg
gggggtggatacactattcgtaatgttgctcgatgttggacatacgagactgcagttgcc
cttgattgtgagattcccaatgaattgccatataatgattactttgagtattttggcccg
gacttcaaactgcatattagtccttcaaacatgacaaaccagaacactccagaatatatg
gaaaagataaaacagcgtttatttgaaaatttacgcatgttacctcatgcacctggcgtc
cagatgcaagctattccagaagatgctgttcatgaagacagcggagatgaagatggagaa
gatccggataagagaatttctattcgagcctcagacaaacggatagcttgtgatgaagaa
ttctcagattctgaggatgaaggagaaggaggacgtagaaatgtggctgatcataagaaa
ggagcaaagaaagctagaattgaagaagacaagaaggaaacagaggacaaaaaagcagac
gttaaggaagaagataaatccaaggacagtagtggtgaaaaaacagataccaaaggagcc
aaatcagaacagctcagcaacccttga

DBGET integrated database retrieval system