KEGG   Ailuropoda melanoleuca (giant panda): 100477763
Entry
100477763         CDS       T01329                                 

Gene name
BCL2L11
Definition
(RefSeq) bcl-2-like protein 11 isoform X2
  KO
K16341  Bcl-2-like protein 11
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml04068  FoxO signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04210  Apoptosis
aml04215  Apoptosis - multiple species
aml04932  Non-alcoholic fatty liver disease
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05206  MicroRNAs in cancer
aml05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100477763 (BCL2L11)
   04151 PI3K-Akt signaling pathway
    100477763 (BCL2L11)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100477763 (BCL2L11)
   04215 Apoptosis - multiple species
    100477763 (BCL2L11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100477763 (BCL2L11)
   05206 MicroRNAs in cancer
    100477763 (BCL2L11)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100477763 (BCL2L11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100477763 (BCL2L11)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100477763 (BCL2L11)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100477763 (BCL2L11)
SSDB
Motif
Pfam: Bclx_interact Bim_N
Other DBs
NCBI-GeneID: 100477763
NCBI-ProteinID: XP_011236242
Ensembl: ENSAMEG00000004790
UniProt: G1LDR8
LinkDB
Position
4
AA seq 196 aa
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEQQGNPEGEGDRCPQGSPQGPL
APPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAF
NHYLSAMASMRQSQAVPADMRPEIWIAQELRRIGDEFNAYYPRRVFLNNYQAAEAHPQMI
ILRLLRYIVRLVWRLQ
NT seq 591 nt   +upstreamnt  +downstreamnt
atggcaaagcaaccttcagatgtaagttctgagtgtgacagagaaggtggacaactgcag
cctgctgagaggcctcctcagctcaggcctggggcccctacctctctacagacagagcag
caaggtaatcctgaaggcgaaggggaccgctgcccccaaggcagccctcagggcccgctg
gccccaccagccagcccaggcccttttgctaccagatccccgcttttcatctttgtgaga
agatcctccctgctgtctcgatcctccagtgggtatttctcttttgacacagacaggagc
ccggcacccatgagttgtgacaaatcaacacaaaccccaagtcctccttgccaggccttc
aaccattatctcagtgcaatggcttccatgaggcagtctcaggctgtacctgccgatatg
cgcccggagatatggattgcgcaagagttgcggcgtattggagacgaatttaatgcatat
tacccaaggagggtctttctgaataattaccaagcagccgaagcccacccccaaatgatt
atcttgcgactgttacgttacatcgtccgcctggtgtggagattgcagtga

DBGET integrated database retrieval system