KEGG   Ailuropoda melanoleuca (giant panda): 100477834
Entry
100477834         CDS       T01329                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta-1
  KO
K02105  catenin beta 1
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04015  Rap1 signaling pathway
aml04310  Wnt signaling pathway
aml04390  Hippo signaling pathway
aml04510  Focal adhesion
aml04520  Adherens junction
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04670  Leukocyte transendothelial migration
aml04916  Melanogenesis
aml04919  Thyroid hormone signaling pathway
aml04934  Cushing syndrome
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05100  Bacterial invasion of epithelial cells
aml05132  Salmonella infection
aml05160  Hepatitis C
aml05163  Human cytomegalovirus infection
aml05165  Human papillomavirus infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05210  Colorectal cancer
aml05213  Endometrial cancer
aml05215  Prostate cancer
aml05216  Thyroid cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
aml05412  Arrhythmogenic right ventricular cardiomyopathy
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100477834 (CTNNB1)
   04310 Wnt signaling pathway
    100477834 (CTNNB1)
   04390 Hippo signaling pathway
    100477834 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100477834 (CTNNB1)
   04520 Adherens junction
    100477834 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100477834 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100477834 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100477834 (CTNNB1)
   04916 Melanogenesis
    100477834 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100477834 (CTNNB1)
   05205 Proteoglycans in cancer
    100477834 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100477834 (CTNNB1)
   05225 Hepatocellular carcinoma
    100477834 (CTNNB1)
   05226 Gastric cancer
    100477834 (CTNNB1)
   05216 Thyroid cancer
    100477834 (CTNNB1)
   05217 Basal cell carcinoma
    100477834 (CTNNB1)
   05215 Prostate cancer
    100477834 (CTNNB1)
   05213 Endometrial cancer
    100477834 (CTNNB1)
   05224 Breast cancer
    100477834 (CTNNB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100477834 (CTNNB1)
   05022 Pathways of neurodegeneration - multiple diseases
    100477834 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100477834 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100477834 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100477834 (CTNNB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100477834 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    100477834 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100477834 (CTNNB1)
   05163 Human cytomegalovirus infection
    100477834 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100477834 (CTNNB1)
   05165 Human papillomavirus infection
    100477834 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 100477834
NCBI-ProteinID: XP_002923854
Ensembl: ENSAMEG00000011615
UniProt: G1LYU0
LinkDB
Position
6
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctacccaagctgatttgatggagctggacatggccatggagccagacagaaaagca
gctgttagtcactggcagcaacagtcttacctggactctggaatccattctggtgccact
accacagctccttctctgagtggtaaaggcaatcccgaggaagaggatgtggataccacc
caagtcctgtacgagtgggaacagggcttttctcagtccttcactcaagaacaagtagct
gatattgatggtcagtatgcgatgactcgagctcagagggtgcgagctgctatgttccct
gagacattagatgagggcatgcagatcccatccacacagttcgatgccgctcatcctact
aatgtccagcgtttggctgaaccatcacagatgctgaaacatgcagttgtaaatttgatt
aactatcaagatgatgcagaacttgccacacgtgcaatccctgaactgacaaaactgcta
aacgatgaggaccaggtggtggttaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttccagacacgccatcatgcgttctcctcagatggtgtctgctattgtacgc
accatgcagaatacaaatgatgtggaaacagctcgctgtactgctgggaccttgcacaat
ctttctcatcaccgtgagggcttactggccatctttaagtctgggggcattcctgccctg
gtgaagatgcttggctcaccagtggattctgtattattttatgccattacaactctccac
aaccttttattgcatcaagaaggagctaaaatggcagtgcgtttagctggtgggctgcag
aaaatggttgccttgctcaacaaaacaaatgttaaattcttggctattacaaccgactgc
cttcagattttagcttacggcaatcaagaaagcaagctgatcattctggctagtggtgga
cctcaagctttagtaaatataatgaggacctacacttatgagaaactactgtggaccaca
agcagggtactgaaggtgctgtctgtctgctctagtaataaaccagctattgtagaagca
ggtggaatgcaagctttagggcttcacctgacagatccaagtcaacgtcttgttcagaat
tgtctttggactcttaggaatctatcagatgctgcaactaaacaggaagggatggaaggt
cttcttgggaccctcgttcagcttctgggctcagatgatataaatgtggtcacctgtgca
gctggaattctttctaatctcacttgcaataattataagaacaagatgatggtctgccaa
gtgggtggtatagaggcgctcgtgcgtactgtccttcgtgctggtgacagggaggacatt
actgagcctgccatctgtgctcttcgtcatctgaccagccgacaccaggaagcagagatg
gcccagaatgctgttcgccttcactatggactaccagttgtggttaagctcctgcaccca
ccatcccactggcctctgataaaggctactgttggattgattcgaaatcttgccctttgt
ccagcaaatcatgcacctctgcgtgagcagggtgccattccgcgactagttcagttgctg
gttcgtgcccatcaggatacccagcgccgtacatctatgggtggaacacagcagcagttt
gtggagggggtccgtatggaagaaattgttgaaggttgtactggagcccttcatatccta
gctcgggatgttcacaaccgaattgtaatcagaggactaaacaccattccactgtttgtg
cagctgctttattctcccattgaaaatatccaaagagtagctgctggggtcctctgcgaa
cttgctcaggacaaggaggctgcagaagccatcgaagcggagggagccacagctcctctg
acagagttacttcactctaggaacgaaggtgtagcaacatatgcagctgctgttttgttc
cgaatgtctgaggacaagccacaggattacaagaaacggctttcggttgagctgaccagt
tctctcttcagaacagagccaatggcttggaatgagactgctgatcttggacttgatatt
ggtgcccagggagaacctcttggatatcgccaggatgatcccagctatcgttcttttcac
tctggtggatatggccaggatgcgttgggtatggaccccatgatggagcatgagatgggt
ggccaccaccctggtgctgactatccagttgatgggctgccagatctggggcatgcccag
gacctcatggatgggctgcctccaggcgacagcaatcagctggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system