KEGG   Ailuropoda melanoleuca (giant panda): 100478117Help
Entry
100478117         CDS       T01329                                 

Definition
(RefSeq) steroid 21-hydroxylase
  KO
K00513  steroid 21-monooxygenase [EC:1.14.14.16]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00140  Steroid hormone biosynthesis
aml01100  Metabolic pathways
aml04925  Aldosterone synthesis and secretion
aml04927  Cortisol synthesis and secretion
aml04934  Cushing syndrome
Module
aml_M00109  C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100478117
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    100478117
   04927 Cortisol synthesis and secretion
    100478117
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100478117
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:aml00199]
    100478117
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     100478117
Cytochrome P450 [BR:aml00199]
 Cytochrome P450, animal type
  CYP21 family
   100478117
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 100478117
NCBI-ProteinID: XP_019665894
Ensembl: ENSAMEG00000002318
LinkDB All DBs
Position
Un
AA seq 518 aa AA seqDB search
MLLLGLLLLTLLAGAHLLWHKWQLRSLHLPPLVPGFLHLLQPNLPLYLLGLTQKLGPVYR
LRLGLRGQSAPSPPPPRWEGGLPSRLTSCFDPPPDVVVLNSKRTIEEAMIRKWVDFAGRP
QTPSYQLVSQHDQDLSLGDYSLLWKAHKKLTRSALLLGLRSSTEPLVEQLTQEFCERMRA
QAGAPVAIQKEFSFLTCAIICHLTFGDKEDTLVHAFHDCVQDLMKTWEHWSIQILDIVPF
LRFLPNPGLWRLKQALENRDHMVEKQLRQHKESMVAGQWRDMMDYMLQRVGKPRVEEDHG
QLLEGHVHMSVVDLFIGGTETTATTLSWAVAFLLHHPEIQRRLQEELDRELGPGASGSRI
PYRDPARLPLLTATIAEVLRLRPVVPLALPHRTTRPSSILGYDIPEGTIVIPNLQGAHLD
ETVWERPHEFRPDRFLVPGASPRVLAFGCGARVCLGEPLARLELFVVLAQLLRAFTLRPX
ALPSLQPRTHCGVNLTVQPFQVQLQPRGAAAQALGQHP
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgctccttctcgggctgctgctgctgaccctgctggctggtgcccacctgctgtggcac
aagtggcagctccgcagcctccacctcccaccccttgtgcccggcttcctgcacctgctg
cagcccaaccttcccctctatctgctgggtctgacccagaaactggggcctgtctacagg
ctccgcctggggctgcgaggtcagtctgctccttccccgcccccgccacggtgggaaggc
gggctcccctccaggctgacatcctgctttgaccctcccccagatgtggtggtgctgaac
tccaagaggaccatcgaggaagccatgatcaggaaatgggtggactttgccggcagaccc
cagacgccgtcctatcagctggtgtctcagcacgaccaggacctctccctcggggactac
tccctgctctggaaggctcacaagaaactcacccgctcggccctgctgctgggcctccgc
agctccacggagccgctggtggagcagctgacccaggagttctgtgagcgcatgagagcc
caggccggtgcccccgtggccatccagaaggagttctctttcctcacctgcgccatcatc
tgtcacctcacttttggagacaaggaggacaccttagtacatgcctttcatgactgtgtc
caagacttgatgaaaacctgggagcactggtccatccaaattttggacatcgttcccttt
ctcaggttcctccccaacccaggcctctggaggctgaagcaggccttggagaacagggac
cacatggtagagaagcagctgcggcagcacaaggagagcatggtggcaggccagtggagg
gacatgatggactatatgctccagagagtggggaagccgagagtggaagaggaccacgga
cagctgcttgaagggcacgtgcatatgtctgtggtggacctgttcattggcggcacagag
accacggcgaccaccctctcctgggccgtggcgttcttgcttcaccaccctgagattcag
cggcgactccaggaagagctggatcgtgagttgggccctggagcctcaggctcccgaatc
ccgtacagagaccctgcacggctgccgttgctcacggccaccatcgccgaggtgctgcgc
ctgcggcctgtcgtgcccctggccttgccacaccgcaccacgcggcctagcagcatcttg
ggctacgacatccctgagggcacgattgtcatccccaacctgcaaggcgcccacttagac
gagacagtctgggagcggccacacgagttccggccggatcgtttcctggtccccggcgcc
agccccagagtgctggcctttggctgcggggcgcgcgtgtgcctgggggagccgctggcg
cgcctggagctcttcgtggtgctggcgcagctgctgcgggccttcacgctgcggccgnnc
gccctgccctccctacagccacgcacccactgcggcgtcaacctcaccgtgcagcccttc
caggtgcagctgcagccccggggtgctgcggcccaggcgctgggccagcacccgtga

DBGET integrated database retrieval system