KEGG   Ailuropoda melanoleuca (giant panda): 100478201
Entry
100478201         CDS       T01329                                 

Gene name
SFN
Definition
(RefSeq) 14-3-3 protein sigma
  KO
K06644  stratifin
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04110  Cell cycle
aml04115  p53 signaling pathway
aml04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:aml00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100478201 (SFN)
   04115 p53 signaling pathway
    100478201 (SFN)
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100478201 (SFN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    100478201 (SFN)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100478201 (SFN)
  Exosomal proteins of colorectal cancer cells
   100478201 (SFN)
  Exosomal proteins of bladder cancer cells
   100478201 (SFN)
SSDB
Motif
Pfam: 14-3-3 SIKE
Other DBs
NCBI-GeneID: 100478201
NCBI-ProteinID: XP_034503256
LinkDB
Position
2
AA seq 281 aa
MERASLIQKAKLAEQAERYEDMAAFMKSAVEKGEELSCEERNLLSVAYKNVVGGQRAAWR
VLSSIEQKGNEESSEEKGPEVREYREKVETELRGVCDTVLGLLDTHLIREAGDAESRVFY
LKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFH
YEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDKRKPAEARGPLFLPL
SVLLTRGQPTRPCSPHPSEPHRRPGHLSPSCLPPAPVASES
NT seq 846 nt   +upstreamnt  +downstreamnt
atggagagagccagtctgatccagaaggccaagctggcagagcaggccgaacgctatgag
gacatggcagccttcatgaagagtgccgtggaaaagggtgaggagctatcctgcgaagag
cgaaacctgctctcggtggcctacaagaacgtggtggggggccagagggctgcctggagg
gtcctgtccagtattgagcagaaaggcaacgaagagagctcggaagagaagggccccgag
gtgcgagagtaccgggagaaggtggagactgagctccggggcgtgtgtgacacggtgctg
ggcctgctggacacccacctcatcagggaggccggtgatgccgaaagtcgggtcttctac
ctgaaaatgaagggcgactactaccgctacctggctgaggtggccactggggacgacaag
aagcgcatcattgactcagcccggtcggcctaccaggaggccatggacatcagcaagaag
gagatgccacccaccaaccccatccgcctggggctggccctgaacttttctgtcttccac
tacgagatcgccaacagccccgaggaggccatctcactggccaagaccaccttcgacgag
gccatggctgacctgcacaccctcagcgaggactcctacaaagacagcaccctcatcatg
cagctgctgcgggacaagcggaagcccgctgaagccagggggccgctcttcctgccgctg
tcggtgctcctcaccaggggccagcccacccgcccctgctcgccgcacccctccgaaccc
caccgccgaccgggccacctctccccctcctgcctccctcccgcccccgttgcctctgaa
tcttag

DBGET integrated database retrieval system