KEGG   Ailuropoda melanoleuca (giant panda): 100478438Help
Entry
100478438         CDS       T01329                                 

Gene name
KMT5C
Definition
(RefSeq) lysine methyltransferase 5C
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100478438 (KMT5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aml03036]
    100478438 (KMT5C)
Enzymes [BR:aml01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100478438 (KMT5C)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100478438 (KMT5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 100478438
NCBI-ProteinID: XP_002926449
Ensembl: ENSAMEG00000003722
UniProt: G1LAK2
LinkDB All DBs
Position
Un
AA seq 461 aa AA seqDB search
MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQHHLRSALEAFLRQRD
LEAAYRALTLGGWMAHYFQSRGPRQEAALKTHIYRYLRAFLPESGFTILPCTRYSMETNG
AKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPADGNAACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECYTCERKGEG
AFRLRPREPLPPRPLDKYELRETKRRLQQGLDGGGRQGPLGPRACAHLSPLRRDPFCAAC
QPLRPLPCSARPDTSPLWLQWLPQPQLRVRPRRRRRPQPRRAPAPPILRAARVSLHQWGG
CGPRCCLRAEALVALGPAPRAHWAPQQDWHWARRYGLPYVVRVDLSRVAPAPLAAPAPAG
TPGPAPIPKQALAFAPFSPPKRLRLVVSHGSIDLDVNGDGP
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgggacctgacagagtaacagccagagagctgtgtgagaatgacgaccttgccaccagc
ctcgtcctggacccctacctcggcttccgcacccataagatgaacgtcagccccgtgccc
cccctgcggcgacagcaccacctgcgctcagcgctggaggccttcctgaggcagcgggac
ctggaggctgcgtaccgggccctgacgctgggaggctggatggcccactacttccagagc
cggggcccccggcaggaggctgccctcaagacccacatctatcgctacctccgagccttc
ctgcctgaaagcggctttaccatcctgccctgtacacgctattccatggagacaaatgga
gccaagattgtgtctaccagagcttggaagaagaacgagaagctggaactgctggtgggc
tgcattgcggagctgcgggaggccgacgaggggctgctgagggccggggagaacgacttt
agcatcatgtactccacccgaaagcgcagtgcgcagctgtggctaggccccgctgccttc
ataaaccatgactgcaaacccaactgcaagtttgtgcccgcagatgggaacgcggcctgc
gtgaaggtgctccgggacattgagcctggggatgaggtgacctgtttctacggggagggc
ttctttggtgagaagaatgagcactgtgaatgctacacctgtgagaggaaaggcgaggga
gccttccgcctgcggcccagggaacccctgccccctcggcccctggacaagtatgagctc
cgggagaccaagcggaggctgcaacagggcctggacggtggtggccggcagggcccgctg
ggcccgagggcctgtgcccacctctccccactgcgccgggacccgttctgtgctgcctgc
cagcccctgcgccccctgccctgcagcgctcgccctgacacctcgcccctctggctccag
tggctgcctcagccccagctcagggtgcgcccccggaggcgccgacgcccccagccccgg
cgggccccagcaccacccattctccgtgctgcccgcgtctccttgcaccagtggggaggc
tgtggcccccgctgctgcctccgcgcagaggccttggtggctctgggcccagccccccgt
gcccactgggcccctcagcaggactggcactgggcccggcgctatgggctgccttatgtg
gtgcgtgtggacctgagccgggtggccccagccccacttgctgcccctgcccctgccggg
accccaggccctgcccccatccccaaacaggcccttgcctttgcccccttctccccaccc
aagcgcctgaggctggtggtcagccatggctccattgacctggatgtcaatggtgatggg
ccttga

DBGET integrated database retrieval system