KEGG   Ailuropoda melanoleuca (giant panda): 100478541Help
Entry
100478541         CDS       T01329                                 

Gene name
SETD1B
Definition
(RefSeq) SET domain containing 1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100478541 (SETD1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aml03036]
    100478541 (SETD1B)
Enzymes [BR:aml01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100478541 (SETD1B)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100478541 (SETD1B)
   HMT complexes
    COMPASS/SET1 complex
     100478541 (SETD1B)
    COMPASS/SET1 complex (yeast)
     100478541 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 100478541
NCBI-ProteinID: XP_019656616
LinkDB All DBs
Position
Un
AA seq 1844 aa AA seqDB search
MENSHPPPHHHXXXXXXXXPGPSGERRNHHWRSYKLMIDPALKKGHHKLYRYDGQHFSLA
IDEFYVGPVPPKQVTFAKLNDNIRENFLRDMCKKYGEVEEVEILYNPKTKKHLGIAKVVF
ATVRGAKEAVQHLHSTSVMGNIIHVELDTKGETRMRFYELLVTGRYTPQTLPVGELDAVS
PIVNETLQLSDALKRLKDGSLSAGCGSGSSSVTPTSGGTPFSQDTAYSSCRLDTPNSYGQ
GTPLTPRLGTPFSQDSSYSSRQPTPSYLFSQDPTVTFKARRHESKFTDAYNRRHEHHYVH
NSCAVAAVAGAPAAFRSSMDLPFGAVSSSGGNSGPPFKAQPQDSATFAHTPPPAQATPTP
GVTFKSTFSPYQTPVPPFPPPPEEPATTTTFGARDSGEFRRAPVPPPLPPTEPLTKEKPG
TPPGPPPPDANSMELGGRPTFGWSPEPCDSPGTPTLESSPAGLEKPHDSLDSRIEMLLKE
QRTKLPFLREQDSDTELQMEGSPISSSSSQLSPLAPFGTNSQPGFRGPTPPSSRPSSTGL
EDISPTPLPDSDEDDELDLGLGPRPPPEPGPPDPSGLLGQTTEVALDLAGDRTPTSEKMD
EGQQSSGEDMEISDDEMPSAPITSADSPGVPPPPILPPLPPFPPGLFPVMQVDMSHVLGG
QWGGMPMSFQMQTQMLSRLMTGQGACPYPPFMAAAAAAASAGLQFVNLPPYRGPFSLSNS
GPGRGQPWPPLPKFDPSVPPPGYVPRQEDPHKATVDGVLLVVLKELKAIMKRDLNRKMVE
VVAFRAFDEWWDKKERMAKASLTPVKSGEHKDEDRPKPKDRIASCLLESWGKGEGLGYEG
LGLGIGLRGAIRLPSFKVKRKEPPDTASSGDQKRLRPSTSVDEEDEESERERDRDMADAP
CELTKRDPKGVGVRRRPARPLELDSGGEEDEKESLSVSSSSSASSSSGSSTTSPSSSASD
KEERESTEEEEDGEEEEEEEEDDDEEEEEGPRSQVSSSSTSSMSDKDDEDSDDQDESEND
DEDVALSEASEKEEGDSDGEETVSIATSKAGAGSSSESSESSEFESSSESSSSSSEDEEE
LVAREEEEEEEEEEAAADESVVPAVPDEDFEEDVATGAPVMESSVMEEEVDIEAEDEAPE
ERTPMLEEPPLPVCVEELASCKEPPEEQDLKQEGARLLSPEPPAGEMEARPPASPERTPE
DDLEVEPPTLLSLPLQPPQPPPXXXXXXXXPPQPPRPPSPPPEPETPDPPHPPVPLEPPP
EEQPPRTPGLCGSLAKSQSTETVPATPSGEPPLSGGSSGLSLSSPQVPGSPFSYPSQSPS
LSSGGLPRTPGRDFSFTPTFPEPGGPLLLPVCPLPAGRRDERSGPLASPVLLETGLPLPL
PLPLPLPLALPVPVLRAQTRAPAQLPPLLPAPLAPCPPPIKRKPGRPRRSPPAVLSLDGP
LXPPAGATLGRDLLLLPGQPQTPVFPSTHDPRAVXPPVESTKLPFKELENQWPSEAIPPG
PRGRDEVTEEFMDLAKVRGHWRRPPKKRHEDLVAPASPELSPPQPLFRPRSEFEEMTILY
DIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYHPSTSLSSAKKKKRDDGIREH
VTGCARSEGFYTIDKKDKLRYLNSSRASTDEPPTDTQGMSIPAQPHASTRAGSERRSEQR
RLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLFAMEPIAADEMVIEYVGQNIR
QVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQ
KKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCRGTLN
NT seq 5535 nt NT seq  +upstreamnt  +downstreamnt
atggagaacagtcacccccccccccaccaccaccnnnnnnnnnnnnnnnnnnnnnnnccc
ggcccttctggagagaggaggaaccaccattggagaagttacaagttgatgattgacccg
gctctgaaaaaggggcatcataaactgtaccgctacgatgggcagcatttcagcctggcg
atcgatgagttctacgtgggcccggtgcctccgaaacaggtgacatttgccaagctgaat
gataacatccgagaaaacttcctgagggacatgtgtaagaagtatggcgaggtggaggag
gtggaaattttgtacaaccctaagaccaagaagcacttgggcattgccaaggtggtcttt
gccacggtcaggggagccaaggaggctgttcagcacctgcacagcacctcagtcatgggc
aatatcatccacgtggagctggacactaaaggggaaacccgcatgcggttctacgaactg
ttggtcacgggccgatacacaccccagaccctcccagtgggcgagctggatgctgtctct
ccaattgtgaacgagaccctgcagctgtcagatgctctgaagcgcctcaaggatggtagc
ctgtctgcaggctgtgggtctggctcctcttctgtcacccccactagtggcgggacaccc
ttctcccaggacactgcatactccagctgccgcctggacacacccaactcctacggacag
ggcacaccgctcacgccgcgcctgggcacccccttctcgcaggactccagctactccagc
cgccagcccacaccctcctacctcttcagccaggaccccacagtgaccttcaaggcccgg
cgtcatgaaagcaagttcacagatgcctacaaccgccgtcatgagcatcattatgtccac
aactcttgtgcggtcgctgcagtggcaggggccccagctgccttcaggagctccatggac
ctcccatttggggcagtcagcagcagtgggggcaacagtggccctccgttcaaggcccaa
ccacaggattcggccacgttcgcccacactccaccacctgcccaagcaacccccactccc
ggagtcacattcaagtcgactttctctccgtatcagactcctgtgccccctttcccccca
ccccccgaggagcccgccaccacaaccacctttggggcccgtgacagcggggaattccgg
agagcacctgtgcccccacccctgccacccactgagcccctgaccaaggagaagccaggc
acacctcctggcccaccacctcccgacgccaacagcatggagttgggtggccggccgacc
tttggctggagtcctgagccctgcgacagtccaggcacgcctacgctggagtcatcacct
gcggggctggagaagccccacgacagcttggactcacgcatagagatgctgctgaaggaa
cagcgcaccaagctgcctttccttcgggagcaggattcggatacggagctgcagatggag
ggcagccctatctcctcttcctcctcccagctctccccactggccccctttggtaccaac
tcccagccaggctttcgaggccccacaccaccctcctcacgcccctccagcactggcctg
gaggatatcagtcccacgccactgcctgactcagacgaggatgatgagcttgacctgggc
ttggggccccggccccctccggagccaggccctccggacccttctggtcttctgggccag
acaactgaggtagccttggacctggctggagacaggaccccaacctcagagaagatggat
gagggccagcagtcctcgggcgaggacatggagatctcggatgatgagatgccctcagcc
cccatcaccagcgccgactcacctggcgtcccacccccgcccatcctgccaccgctgcca
cccttccctccagggctgtttcctgtgatgcaggtggatatgagccacgtgctgggtggc
cagtggggcggcatgcccatgtccttccagatgcaaacgcagatgctgagccgtctgatg
actggccagggcgcttgcccgtacccacccttcatggccgcggctgcggcggcggcctca
gctgggctgcagtttgtcaacctgccgccctaccggggcccgttctccctgagcaacagc
ggaccaggccgcgggcagccctggccacccctccccaagtttgacccatcagtgccgcca
ccaggctatgtgccacgccaggaggacccacacaaggccactgtcgatggcgtcctgctg
gtggtgctcaaagagctcaaggccatcatgaagcgcgacctgaaccgcaagatggtggag
gtggtggccttccgggccttcgatgagtggtgggacaagaaggagcggatggccaaggcc
tcactgaccccagtgaagtcaggcgagcacaaggacgaggacaggccaaagcccaaggac
cgcatagcctcgtgcctgctggaatcgtggggcaagggtgagggcctgggctatgagggc
ctcggcctgggcatcgggctgcgcggggccatccgcctgccctccttcaaggtaaagagg
aaggagccgccagacacagcctcttctggtgaccagaagcgcctgcggccttcaacctct
gtggatgaggaagatgaagagtcagagcgtgaacgggaccgggacatggcggatgcccct
tgcgagctcaccaagcgggaccccaagggtgtgggcgtgcggcgacggccagcccggccg
ctggagctggacagtgggggggaggaggacgagaaggagtcactgtcagtgtcctcatca
tcatcggcgtcctcatcctcgggctcctccacaacctcaccctcatcctcggcctccgac
aaggaggagcgggaaagcactgaagaggaagaggacggagaggaggaagaggaggaggaa
gaggatgacgacgaggaggaggaggaaggccccaggagccaggtctcctcctcctcgacc
tcatccatgtcagataaggacgatgaagacagtgatgaccaggatgagtctgagaatgac
gacgaggacgtagccctgtcggaggcgagtgagaaggaagaaggggactcggatggagag
gagacagtgagcatcgccacctccaaggctggagccgggtcctccagcgagagttctgag
tcttctgagttcgagtcaagctcggagtcctcgtcatcgtcctcagaggatgaagaggag
ctggtggcaagggaggaagaggaggaggaggaggaggaagaggcagcagcagatgaaagt
gtggttcctgcggttcccgacgaggactttgaggaggatgtggccacaggggcacctgtg
atggagtcctcggtcatggaagaggaggtggacatcgaggctgaggatgaagcccccgag
gagcggacccctatgctggaagagccccccttgcctgtgtgtgtcgaggagctggctagc
tgcaaggagccccctgaggagcaggacctgaagcaggaaggggccaggttgctgtctcca
gagccccctgctggagagatggaggcccggcccccggcttccccagagcgcaccccagag
gatgacctggaagtggagccccctacactgctctccttacccctgcagccgccacaacca
ccccctcannnnnnnnnnnnnnnnnnnnnnccccctcaaccgccccggccgcctagccca
ccaccagagcctgagaccccagaccccccacacccacccgtccctctggagccccctcca
gaggagcagcccccacgtactccgggcctctgtggcagcttggccaagtcacagagtaca
gagacggtgccggccacgccgagcggggagcccccattgtcggggggcagcagcggcctg
tcactgagctccccacaggtgcccggcagtcccttttcctacccatcccagtcccccagc
ttgagcagtgggggcctccccaggacacctggtcgggacttcagcttcacacccaccttc
cctgagcctggcgggcccctgctcctgcctgtctgtcccctcccagctggccggcgcgat
gagcggtctggccccctggcctccccggtgctcctggagacgggcctgcctctccccctg
cccttgcccctgcccctgcccctggcattacctgtccccgtcctgcgggcccagacacgg
gcccctgcccagctgccacctctgttgcccgcgccactggccccctgcccaccccctatc
aagaggaagccgggcaggccccggcgatctccgccggctgtgctctccttggatgggccc
ttgnggccaccagcgggggccaccctcggcagggaccttctgctcctgccaggccagcca
cagacccctgtctttcccagcacccatgacccccgggccgtgnacccccctgttgagtcc
accaaactgccctttaaggagctagagaaccagtggccctccgaggccatccctccaggc
cctcgcgggcgtgatgaggtcactgaggagttcatggacctggccaaggttcgggggcac
tggcgccggccacctaagaagcgccacgaggacctggtggccccagcctcgcctgagctc
tcgccaccacaacccctcttccggccccggtctgagttcgaggagatgaccatcctgtat
gacatctggaatggtggcatcgatgaggaggacatccgcttcctgtgtgtcacctacgag
cggctgctgcagcaggacaacggcatggactggctcaatgacacactctgggtctaccat
ccctccaccagcctctcttcagctaagaaaaagaaacgggacgatggcatccgtgagcac
gtgacgggctgtgcccgcagcgagggcttctataccatcgacaagaaggacaagctcaga
tacctcaacagtagccgcgccagcaccgatgagcccccgacagacacccagggcatgagc
atcccggcgcagcctcatgcctccactcgggcgggctcggagcggcgttctgagcagcgc
cgtctgctgtcctccttcactggcagctgtgacagtgacctgctcaagttcaaccagctc
aagttccggaagaagaagctcaaattctgcaagagccacattcacgactggggcctgttc
gccatggaacccatcgcggctgacgagatggtcattgagtacgtgggtcagaacatccgc
caggtgatcgcggacatgcgggaaaagcgttacgaggacgagggcattggcagcagctac
atgttccgggtggaccacgacaccatcatcgatgccaccaagtgcggcaactttgcacgc
ttcatcaaccacagctgcaaccccaactgctatgccaaggtgatcacggtggagtcgcag
aagaagattgtcatctactcgaagcagcacatcaacgtcaacgaggagatcacctacgac
tacaagttccccatcgaggacgtcaagatcccctgcctgtgcggctctgagaactgccgg
gggaccctcaactag

DBGET integrated database retrieval system