KEGG   Ailuropoda melanoleuca (giant panda): 100478725Help
Entry
100478725         CDS       T01329                                 

Gene name
HDAC6
Definition
(RefSeq) histone deacetylase 6
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml05034  Alcoholism
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    100478725 (HDAC6)
  09165 Substance dependence
   05034 Alcoholism
    100478725 (HDAC6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aml01009]
    100478725 (HDAC6)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:aml03019]
    100478725 (HDAC6)
   04131 Membrane trafficking [BR:aml04131]
    100478725 (HDAC6)
   03036 Chromosome and associated proteins [BR:aml03036]
    100478725 (HDAC6)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100478725 (HDAC6)
Protein phosphatases and associated proteins [BR:aml01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100478725 (HDAC6)
Messenger RNA biogenesis [BR:aml03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100478725 (HDAC6)
Membrane trafficking [BR:aml04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    100478725 (HDAC6)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100478725 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP zf-UBP_var PKI
Motif
Other DBs
NCBI-GeneID: 100478725
NCBI-ProteinID: XP_019653638
Ensembl: ENSAMEG00000012489
LinkDB All DBs
Position
Un
AA seq 1203 aa AA seqDB search
MEKRASSGTRRPAGRQEFGGVSPGRSVRKGLRPNRVRGEVSPTMTSTGQDSTTTRQRRSR
HNPHSPPHDSSVTSKRGVKKGALLHSSPSLAEVKKKGRMKKLSQAAEQDLIVGLQGLDLN
LEAKTLSGTGLVFDEQLNEFHCLWDDSFPECPERLHAIKQQLIQEGLVDRCVSFQARFAE
KEELMLVHSLEYIDLMETTQYMNEGELRILADTYDSVYLHPNSYTCACLASGSVLRLVDA
VLGNEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQKKHAIQRVLIVDWDVHHG
QGTQFAFDRDPSVLYFSIHRYEQGRFWPHLKASNWSTVGFGRGQGYTINVPWNQVGMRDA
DYIAAFLHLLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATPAGFAQLTHLLMGLAGGK
LILSLEGGYNFRSLAEGVSASLHTLLGDPCPILESPGAPCWSAQASLSCALEALEPFWEV
LVRSAETLDEDFLEEENVEKEEEGPWQPPALPVLTWPVLQARTGLVYDQRMMGHYNLWDN
HHPEMPQRVFRIMRRLEELGLAGRCLTLPARPATDSELLTCHSAEYVGRLRATAKMKTRE
LHREGSNFDSIYICPGTFACAQLATGATCRLVEAVLAGEVLNGAAVVRPPGHHAERDAAC
GFCFFNSVAVAARHAQAISGHALRILIVDWDVHHGNGTQHIFEEDPSVLYISLHRYDHGT
FFPMGDEGASSQMGRAAGTGFTVNVAWNGPRVGDADYLAAWHRLVLPIAYEFNPELVLVS
AGFDAARGDPLGGCQVSPEGYAHLTHLLMGLANGRIILILEGGYNLTSISESMAACTRSL
LGDPPPLLTLARPPLSGALASITETIQVHRRYWRSLRVMKVEDKEGPSSSKSITRKVTLP
AHRGPAVQMTAPDRNILDADIGKATSASSVEVSTPDQAKSETAVVALNQDQASEAPTREA
MLDQTPSEAATEGATLDQTIVGTATVGATPGQTTSEEAVREAEVIQTPPALRTDSQTPPA
SPVQGATAQISPSKLTESLRTLDLNSEAQKAPESQSPEEERLLGEAAEGQDRDHSMLIQS
FGDHADGDQVTFYAVIPLPWCPHLVAVGPIPESGLDVTQPCQDCGTLQENWVCLSCYQVY
CGRYVSAHMLQHHGVSGHPLVLSYVDLSTWCYNCEAYVHHQALLDVKSIAHQNKFGEDMP
HSH
NT seq 3612 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagagggcctcctcaggcacccgccgtcccgcgggtcgccaggaatttggcggc
gtgagccctgggcggagtgtgagaaaagggctgcgcccaaaccgcgtcaggggtgaagtc
tccccgaccatgacctccaccggccaggattccaccacaaccaggcagcgaaggagtagg
cataacccccattcgcccccccacgactccagcgtcacctcgaagcgaggtgttaagaag
ggtgccttactccactccagccctagtctagcagaggtaaagaagaaaggcagaatgaag
aagctcagccaagcagcagagcaagacctcatcgtgggcctgcaaggactggatctgaac
cttgaggccaagacactgtctgggactggtttagtgttcgatgagcagctaaatgaattc
cactgcctctgggatgacagcttccctgaatgccctgagcggctccatgccatcaagcaa
cagctgatccaggagggccttgtggaccgctgcgtgtccttccaggctcgctttgctgaa
aaggaggagctgatgttggttcacagcctagaatacattgacctgatggagacgacccag
tacatgaatgagggagagctccgcatcctagcagacacctatgactcagtgtacctgcat
ccgaactcatatacctgtgcctgcctggcctcgggctctgtcctcaggctggtggatgcg
gtcctggggaatgagatccggaatggcatggccatcatcaggcctcctggacaccacgcc
cagcacagtcttatggatggatattgcatgttcaaccacgtggccgtggccgcccgctat
gctcaaaagaagcatgccattcagagggtccttattgtggattgggatgtgcaccatggt
caaggaacacagtttgcctttgaccgggaccccagtgtcctctatttctccatccaccgc
tacgagcagggtaggttctggccccacctgaaggcctctaactggtccaccgtaggtttt
ggccgaggccagggatataccatcaatgtgccttggaaccaggtggggatgcgcgatgcc
gactacattgccgctttcctgcacctccttctgccagtcgcccttgagttccagccccag
ctggtcctggtggccgctggatttgacgccctccaaggggaccccaagggtgagatggcc
gccactccggcaggattcgctcagctaacgcacctgctcatgggtctggcaggaggcaag
ctgatcctgtctctggagggtggctacaacttccgctccctggctgagggcgtcagtgcc
tcactccacacccttctgggagacccttgccccatactggagtctcctggtgccccgtgc
tggagtgcccaggcatcactgtcctgtgctctggaagccctggagcccttctgggaggtc
cttgtaagatcagctgagaccctggatgaggacttcttggaggaggagaacgtggagaag
gaagaagaaggaccgtggcagcccccggcgctcccagtcctgacgtggcccgtgctacag
gctcgcacagggctggtctatgaccagcggatgatgggtcactacaacttgtgggacaac
caccacccagagatgcctcagcgagtctttcggatcatgcgccgtttggaagaactaggc
cttgcagggcgctgcctcaccttgcccgcacgtcccgccacggactccgaactgctcacc
tgccacagtgctgagtacgtgggtcgtctgcgggccacagcgaagatgaaaacgcgcgag
ctgcaccgcgagggctccaactttgactccatctacatctgtcccggcacctttgcctgt
gcccagctggccactggcgccacctgccgcctggtggaggccgtgctggccggagaggtt
ttgaatggcgccgctgtggtgcgtcccccaggacaccacgcggagcgggatgccgcgtgc
gggttttgctttttcaactctgtggctgtggctgctcgccatgcccaagccatcagtggg
catgcgctgcggatcctcatagtggactgggacgtccatcacggtaatggaactcagcac
atatttgaggaagaccccagcgtgctgtacatctccctgcaccgatatgatcacggcacc
ttctttcccatgggggatgagggcgccagcagccagatgggccgggccgcaggcaccggc
ttcactgtcaatgtggcctggaacgggccccgcgtgggtgacgctgactacctggctgcc
tggcaccgtctggtgctccccattgcctacgagtttaacccagaactggtgctggtctcg
gctggctttgacgccgcacggggggacccgctggggggctgccaggtgtcacccgagggc
tatgcccacctcacccacctgctgatgggccttgccaatggccgcatcatcctaatccta
gagggtggctacaacctgacctccatctcggagtccatggctgcctgcacccgttccctc
cttggggacccaccaccactgctaaccctggcgcggcccccgctgtcaggggccctggcc
tccatcaccgagaccatccaagtccatcgcagatactggcgcagcttgcgggtcatgaag
gtcgaagacaaggagggaccttccagttctaagtcaatcaccaggaaggtgaccctgcca
gcccaccgtgggccagctgtgcagatgaccgcaccagacaggaacattctagatgcggac
atagggaaggctacctcagcatcatccgtggaagtgtccaccccagaccaagctaagtca
gagactgctgtggtggcactcaatcaggaccaagcctcggaggctcccaccagggaagcc
atgctggaccagaccccctcagaggcagccacagaaggagccacgctggaccagaccatc
gtggggacggccacagttggagccacgccaggccagaccacctcagaggaagctgtcagg
gaagctgaggtgatccagacccctccagccttacgtactgacagccagactcccccagcc
tcacctgtgcaaggagccacagcccagatatctcccagtaagctgactgagagtctcagg
accttggacctgaacagcgaggctcagaaggcaccagaatctcagagcccagaagaggag
aggctgctaggagaggcagctgaaggtcaggacagggatcattccatgctgattcagagc
tttggggaccatgccgatggtgaccaggtcacgttttatgcggtgataccactgccctgg
tgtccccatttggtggcagtaggtcccatacctgaatcgggcctggatgtgacccaacct
tgtcaggactgtggaacactccaggagaactgggtgtgtctgtcctgctatcaggtctac
tgcggccgttacgtcagtgcgcatatgctgcagcaccacggggtctcaggacacccgctg
gtcctcagctacgtcgacctgtctacctggtgttacaactgtgaggcctatgtccaccac
caggctctcctggatgtgaagagcatcgctcaccagaacaagtttggggaggacatgccc
cactcacactaa

DBGET integrated database retrieval system