KEGG   Ailuropoda melanoleuca (giant panda): 100478808Help
Entry
100478808         CDS       T01329                                 

Gene name
NEU3
Definition
(RefSeq) neuraminidase 3
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00511  Other glycan degradation
aml00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:aml00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100478808 (NEU3)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100478808 (NEU3)
Enzymes [BR:aml01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     100478808 (NEU3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR_3 BNR
Motif
Other DBs
NCBI-GeneID: 100478808
NCBI-ProteinID: XP_011218140
Ensembl: ENSAMEG00000017126
LinkDB All DBs
Position
Un
AA seq 438 aa AA seqDB search
MEEPGSREEVMEEVTSCSFNSPLFQQEDKRGVTYRIPALLYIPPAHTFLAFAEKRSTSKD
EDALHLVLRRGLRTGHSVQWGPVKPLMEATLPGHRTMNPCPVWEQKSGCVYLFFICVRGH
VTERQQVTSGRNAARLCFICSRDAGCSWSEVRDLTEEVIGVEVKRWATFAVGPGHGIQLQ
SGRLVIPAYAYYIPYWFFCFRLPCKAKPHSLMIYSDDLGTTWNHGRLIKPMATVECEVAE
VIGRAGVPVLYCSARTPNRCRAEAFSINHGECFQRPALSSQLCEPPHGCQGSVVSFRPVE
ILQVSQDPHGRDASPIQQSPLLDSSPRLGQEAGPRSESWLLYSHPTSKKRRVNLGIYLNQ
TPLGAACWSRPWVLHCGPCGYSDLAVLEKEGLFGCLFECGTKRECEQIAFRLFTDQEILS
HMQEDCSSPGKDSKPTEN
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggaggagccggggtcccgcgaagaggtcatggaagaagtgacatcgtgctccttcaac
agccctctgttccagcaggaagacaagagaggggtcacctaccggatcccagccctgctc
tacatcccccccgcccacaccttcctggcctttgcagagaagcgctccacgagcaaggat
gaggatgctctccacctggtcctgaggcgagggttgaggactgggcactcagtacagtgg
ggacccgtgaagccattgatggaagccacattacctgggcatcggaccatgaacccctgt
cctgtatgggagcagaagagtggctgtgtgtacctgttcttcatctgtgtgcggggccac
gtcaccgagcgtcagcaggtcacgtcgggcaggaatgcggcccgcctttgcttcatctgc
agtcgagacgccggctgttcatggagcgaggtgagggacctgactgaagaggttattggt
gtagaggtgaagcgttgggccacatttgctgtgggcccaggtcatggcatccagctgcag
tcgggaaggctggtcatccctgcatatgcctactacatcccttactggttcttttgcttc
cggctaccatgtaaagccaagcctcattccctgatgatctacagtgacgacctagggacc
acctggaaccatggcaggctcattaagcccatggcaacagtggagtgtgaagtggcagag
gtgatcgggagggctggcgtccctgtgctgtattgcagcgcccggacaccaaacaggtgc
cgggcagaggctttcagcattaaccacggtgaatgctttcagagaccagccctgagctct
cagctctgtgagcccccacacggctgccaaggcagtgtggtgagtttccggcccgtggag
atccttcaagtgtcccaggaccctcatggcagagatgcttctcccattcagcagagccct
ctgctggacagctccccgaggctagggcaggaagctggaccacggtctgaatcttggctc
ttgtactcacacccaaccagtaagaagcggagggtcaacttaggcatctacctcaaccag
acccccttgggtgcggcctgctggtcccgcccatgggtcttgcactgtgggccctgtggc
tactctgatttggccgttttggaaaaggagggcttgtttgggtgtttgtttgagtgtggg
accaagcgagagtgtgagcagattgccttccgcctctttacagaccaagagatcctgagc
cacatgcaggaggactgcagcagccctggtaaggactctaagccaactgaaaactaa

DBGET integrated database retrieval system