KEGG   Ailuropoda melanoleuca (giant panda): 100478898
Entry
100478898         CDS       T01329                                 

Gene name
TFRC
Definition
(RefSeq) transferrin receptor protein 1 isoform X1
  KO
K06503  transferrin receptor
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04066  HIF-1 signaling pathway
aml04144  Endocytosis
aml04145  Phagosome
aml04216  Ferroptosis
aml04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100478898 (TFRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100478898 (TFRC)
   04145 Phagosome
    100478898 (TFRC)
  09143 Cell growth and death
   04216 Ferroptosis
    100478898 (TFRC)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100478898 (TFRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:aml01002]
    100478898 (TFRC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    100478898 (TFRC)
   04090 CD molecules [BR:aml04090]
    100478898 (TFRC)
Peptidases and inhibitors [BR:aml01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   100478898 (TFRC)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100478898 (TFRC)
  Exosomal proteins of colorectal cancer cells
   100478898 (TFRC)
CD molecules [BR:aml04090]
 Proteins
  100478898 (TFRC)
SSDB
Motif
Pfam: Peptidase_M28 PA TFR_dimer Blt1_C Uso1_p115_head
Other DBs
NCBI-GeneID: 100478898
NCBI-ProteinID: XP_002916807
Ensembl: ENSAMEG00000003898
UniProt: G1LBB8
LinkDB
Position
1
AA seq 770 aa
MMDQARSAFSTLFGGEPLSYTRFSLARQVDGDNSHVEMKLAADEEESVDNNVRGNLASVT
KPKRFNGFICYGTIAVIVFFLIGFMIGYLGYCKRVEPKAECERLSGTESLGIVGTEPPER
EEYAPETSNRFFWTDLKTMLSKRLNDTEFATTIRQLNENPYVPREAGSQKDDSLAFFIEN
QFRTYPLTRAWHDEHFVKIQVKSSSAQNSVTIVGTDSGVVYLVESPEGYVAYSKAATVTG
RLVHANFGTKKDFENLNSPVNGSLVIVRAGKITFAEKVANAQSFNASGVLIYMDQSRFPI
VDAEVPVFGHAHFGTGDPYTPGFPSFNHTQFPPSQSSGLPGIPVQTISRAAAEKLFENME
GDCPSAWEIDSSCRLETSRNRNVKLTVNNVLKEIRIFNVFGVIKGFEEPDRYVVVGAQRD
AWGPGAAKSSIGTALLLELAQIFSDMVSKGGYRPSRSIVFASWSAGDFGAIGATEWLEGY
LSSLHLKAFTYINLDKAVLGTKNFKVSASPLLYSLIEKTMKDVKHPVTGQSLYQDSNWIN
KVEEFSLDNAAFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDNYENLKRKIPLLNQMARGA
AEVAGQLIMKLTYDFKLNLNYEMYNDKILSFVRDMNRFRADMKEMGLNLQWLYSARGDFF
RATSRLTTDYKNAESTNRFVMREINDRIMKVEYHFLSPYVSPRDSPFRHIFWGSGSHTLS
ALLEHLKLRQKNNSAFNETLLRNQLALATWTIQGAANALSGDIWDIDNEL
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgatggatcaagccagatcagcattctctaccttgtttggtggagaaccattgtcctat
acccggtttagtctggcacggcaagtagatggtgataacagtcatgtggagatgaaacta
gctgcagatgaagaagaaagtgttgacaataacgtgaggggtaatcttgccagtgtcaca
aaaccaaaaaggtttaatggatttatctgctatgggactattgctgtaatcgtctttttc
ttgattggatttatgattggctacttgggctattgtaaacgtgtggaaccaaaagctgaa
tgtgagagactatcaggaacggagtctctggggatagtgggaacagaacctccagaaaga
gaagagtacgcacctgaaacatccaatcgttttttttggacggacctcaaaacaatgttg
tcaaagagactgaatgacacagagttcgccaccaccatcaggcagctgaatgaaaatccg
tatgttcctcgtgaggcgggatctcaaaaagatgatagccttgcttttttcattgagaat
caattccgtacatatccacttaccagagcctggcatgatgaacactttgttaagattcag
gtcaaaagcagcagtgctcagaactcggtgaccatagtgggtacggacagtggcgtggta
tacctggtggaaagccctgagggttacgtggcctacagtaaggcggcgacagttactggt
agactggtccatgctaattttggcaccaaaaaagactttgagaatttaaactctcctgtg
aatggatctttagtgattgttagagcaggcaaaatcacttttgctgaaaaggttgcaaat
gctcaaagtttcaatgcaagtggtgtcttgatatacatggaccagtctagatttcccatt
gttgacgcagaggttccagtctttggacatgctcactttggaacaggtgacccgtacaca
cctggattcccttctttcaatcatactcagtttccaccgtctcagtcgtcaggattgccc
ggcattcctgtccaaacaatttccagagctgccgcagaaaagttgtttgaaaatatggaa
ggagactgtccttctgcctgggaaatagactcctcgtgcaggctggagacctcccggaac
aggaacgtgaaactcactgtgaacaatgtgctgaaagagataagaatttttaacgttttt
ggagttattaaaggttttgaagaacctgatcgctatgttgtagtaggggctcagagggat
gcctggggtcctggagctgcgaagtctagcataggaacagctctccttttggagcttgcc
cagatattctctgatatggtctcaaaaggtggctatagacccagcagaagcattgtcttt
gccagctggagtgctggagactttggagcaatcggtgccactgaatggctagagggatac
ctttcctccttgcatttaaaggctttcacttacattaatctggataaagctgttcttggt
accaagaacttcaaggtttctgccagcccgctgttgtattcgcttattgagaaaacgatg
aaagatgtgaaacatccagttactggacagtctctttatcaggacagcaactggatcaac
aaagtcgaggaattttctttggataatgctgctttccctttccttgcgtactctggaatc
ccagcggtttctttctgtttttgtgaggatacagattatccttatttgggcactaccatg
gataactatgagaacctgaaacggaaaattcctctgttgaaccaaatggcacgtggagca
gcggaagtagctggtcagcttataatgaaacttacctatgattttaaattgaacctgaac
tatgagatgtataatgacaaaatactttcatttgtgagggatatgaaccgattcagagca
gacatgaaggagatgggtctgaatctacagtggctgtattctgctcgtggagactttttc
cgtgccacctccagactcacaacagattataagaatgcggagagtacgaacagatttgtc
atgagggaaatcaatgaccgtatcatgaaagtggaatatcacttcctctcaccctacgta
tctccgagagattctcctttccgacatatcttttggggctctggctctcacactctgtca
gctttactagagcatttgaagctgcgtcagaaaaataacagtgcttttaatgaaacactg
ttgagaaaccagttggctctagcaacttggactattcaaggagcggcaaatgccctctct
ggtgacatatgggacattgacaatgagctttaa

DBGET integrated database retrieval system