KEGG   Ailuropoda melanoleuca (giant panda): 100479008Help
Entry
100479008         CDS       T01329                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04068  FoxO signaling pathway
aml04146  Peroxisome
aml04211  Longevity regulating pathway
aml04213  Longevity regulating pathway - multiple species
aml05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100479008 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100479008 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway - mammal
    100479008 (SOD2)
   04213 Longevity regulating pathway - multiple species
    100479008 (SOD2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    100479008 (SOD2)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     100479008 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 100479008
NCBI-ProteinID: XP_002925391
LinkDB All DBs
Position
Un
AA seq 176 aa AA seqDB search
MQLHHSKHHATYVNNLNAIEEKYLEALEKGDITAQVALQPGLKFNGGGHINHSIFWTNLS
PKGGGEPKGELLEAIKRDFGSFEKFKEKLTTVSVGVQGSGWGWLGFNKEQGRLQIAACSN
QDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMAGKK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgcaccacagcaagcaccacgcgacctacgtgaacaacctgaatgccatcgag
gagaagtatctggaggcgctggagaaaggtgacattacagctcaggtagctcttcagcct
gggctcaagttcaatggcggaggccatatcaatcattccatcttctggacaaacctgagc
cctaagggtggtggagaacccaaaggggaattgctggaggccatcaaacgtgattttggt
tccttcgaaaaatttaaggagaagttgaccactgtatccgttggcgtccaaggctcaggt
tggggttggcttggtttcaataaggaacagggacgcttgcagattgctgcttgttctaac
caggatccgctgcaaggaacaacaggtcttattccactactggggatcgatgtgtgggag
cacgcttattaccttcagtataaaaatgtcagaccagattacctaaaagctatttggaat
gtaatcaactgggagaatgtaacggagagatacatggctggcaaaaagtaa

DBGET integrated database retrieval system