KEGG   Ailuropoda melanoleuca (giant panda): 100479189
Entry
100479189         CDS       T01329                                 

Gene name
HMOX1
Definition
(RefSeq) heme oxygenase 1 isoform X1
  KO
K00510  heme oxygenase 1 [EC:1.14.14.18]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml00860  Porphyrin and chlorophyll metabolism
aml01100  Metabolic pathways
aml04066  HIF-1 signaling pathway
aml04216  Ferroptosis
aml04978  Mineral absorption
aml05200  Pathways in cancer
aml05206  MicroRNAs in cancer
aml05225  Hepatocellular carcinoma
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100479189 (HMOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    100479189 (HMOX1)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    100479189 (HMOX1)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    100479189 (HMOX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100479189 (HMOX1)
   05206 MicroRNAs in cancer
    100479189 (HMOX1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100479189 (HMOX1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100479189 (HMOX1)
Enzymes [BR:aml01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     100479189 (HMOX1)
SSDB
Motif
Pfam: Heme_oxygenase
Other DBs
NCBI-GeneID: 100479189
NCBI-ProteinID: XP_011231066
Ensembl: ENSAMEG00000001468
UniProt: G1L3U2
LinkDB
Position
15
AA seq 288 aa
MERPQPASMPEDLSEALKEATKEVHVQAENAEFMKNFQKGQVTRKGFKLVMASLYHIYVA
LEEEIERNKDNPVYAPLYFPEELHRKAALEWDMVFWYGPRWQEAIPYTQATRRYVQRLRE
VGREEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPASGEGVDFFSFPSIASATKFKQ
LYRSRMNTLEMTPEVRQRVLEEAKTAFLLNIQLFEELQELLSRDAEDRSPSQAPGLRRRV
GSRAQDSTPTEAPRGKPQPSLLSQAPLLRWVLTLSFLVATVAVGLYVM
NT seq 867 nt   +upstreamnt  +downstreamnt
atggagcgcccgcagcccgccagcatgcccgaggatttgtcagaggccctgaaggaggcc
accaaggaggtgcatgtccaggcggagaatgccgagttcatgaagaacttccagaagggc
caggtgacccgaaaaggctttaagctggtgatggcctctctgtaccacatttacgtggcc
ctggaggaggagatcgagcgcaacaaggacaacccggtctacgcccccctttacttcccg
gaggagctgcaccgcaaggccgccctggagtgggacatggtcttctggtacggcccccgc
tggcaggaggccatcccctacacgcaggccacgcggcgctacgtgcagcgactccgggag
gtggggcgcgaggagccagagctgctggtggcccacgcctacacccgctacctcggcgac
ctgtcggggggccaggtcctcaagaagatcgcgcagaaagccctggacctgcccgcctcc
ggggagggcgtggacttcttctccttccccagcatcgccagcgccaccaagttcaagcag
ctctaccgctcccgcatgaacactctggagatgacccccgaggtcaggcagagggtcctc
gaagaggccaagactgcgtttctgctcaacattcagctgttcgaggagttgcaggagctg
ctgagccgggacgccgaggaccggagcccctcgcaggccccggggctgcgccggcgggtt
ggcagcagggcgcaagactcaactcccacggaggctcccagagggaagccccagcccagc
cttctgtcccaggcaccgcttctccgatgggtccttacgctcagctttctggtggcaacg
gttgctgtggggctttatgtcatgtga

DBGET integrated database retrieval system