KEGG   Ailuropoda melanoleuca (giant panda): 100479224
Entry
100479224         CDS       T01329                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X2
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01521  EGFR tyrosine kinase inhibitor resistance
aml04012  ErbB signaling pathway
aml04062  Chemokine signaling pathway
aml04110  Cell cycle
aml04150  mTOR signaling pathway
aml04151  PI3K-Akt signaling pathway
aml04310  Wnt signaling pathway
aml04340  Hedgehog signaling pathway
aml04360  Axon guidance
aml04390  Hippo signaling pathway
aml04510  Focal adhesion
aml04550  Signaling pathways regulating pluripotency of stem cells
aml04657  IL-17 signaling pathway
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04722  Neurotrophin signaling pathway
aml04728  Dopaminergic synapse
aml04910  Insulin signaling pathway
aml04916  Melanogenesis
aml04917  Prolactin signaling pathway
aml04919  Thyroid hormone signaling pathway
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml04934  Cushing syndrome
aml04935  Growth hormone synthesis, secretion and action
aml05010  Alzheimer disease
aml05020  Prion disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05135  Yersinia infection
aml05160  Hepatitis C
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05165  Human papillomavirus infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05200  Pathways in cancer
aml05210  Colorectal cancer
aml05213  Endometrial cancer
aml05215  Prostate cancer
aml05217  Basal cell carcinoma
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100479224 (GSK3B)
   04310 Wnt signaling pathway
    100479224 (GSK3B)
   04340 Hedgehog signaling pathway
    100479224 (GSK3B)
   04390 Hippo signaling pathway
    100479224 (GSK3B)
   04151 PI3K-Akt signaling pathway
    100479224 (GSK3B)
   04150 mTOR signaling pathway
    100479224 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100479224 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100479224 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    100479224 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100479224 (GSK3B)
   04657 IL-17 signaling pathway
    100479224 (GSK3B)
   04662 B cell receptor signaling pathway
    100479224 (GSK3B)
   04062 Chemokine signaling pathway
    100479224 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100479224 (GSK3B)
   04917 Prolactin signaling pathway
    100479224 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    100479224 (GSK3B)
   04919 Thyroid hormone signaling pathway
    100479224 (GSK3B)
   04916 Melanogenesis
    100479224 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100479224 (GSK3B)
   04722 Neurotrophin signaling pathway
    100479224 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    100479224 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100479224 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100479224 (GSK3B)
   05225 Hepatocellular carcinoma
    100479224 (GSK3B)
   05226 Gastric cancer
    100479224 (GSK3B)
   05217 Basal cell carcinoma
    100479224 (GSK3B)
   05215 Prostate cancer
    100479224 (GSK3B)
   05213 Endometrial cancer
    100479224 (GSK3B)
   05224 Breast cancer
    100479224 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100479224 (GSK3B)
   05020 Prion disease
    100479224 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    100479224 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100479224 (GSK3B)
   04931 Insulin resistance
    100479224 (GSK3B)
   04934 Cushing syndrome
    100479224 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100479224 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100479224 (GSK3B)
   05162 Measles
    100479224 (GSK3B)
   05163 Human cytomegalovirus infection
    100479224 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100479224 (GSK3B)
   05165 Human papillomavirus infection
    100479224 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100479224 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100479224 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aml03036]
    100479224 (GSK3B)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     100479224 (GSK3B)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   100479224 (GSK3B)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100479224 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 100479224
NCBI-ProteinID: XP_002915300
Ensembl: ENSAMEG00000006975
UniProt: G1LKA6
LinkDB
Position
1
AA seq 433 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPN
VKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANAGDRGQ
TNNVASASASNST
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggatggcagcaaggtgaccacagtg
gtggcaactcctgggcagggtccagataggccacaagaagtcagctatacagacactaaa
gtgattggaaatgggtcatttggtgtggtatatcaagccaaactttgtgattcaggagaa
ctggttgccatcaagaaagtattgcaggacaagagatttaagaaccgagagctccaaatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactcaagtggt
gagaagaaagatgaggtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgctccctgtgatctatgtcaagttg
tatatgtatcagctgttccgaagtttagcctatatccattcctttggaatatgccatcgg
gatattaaaccacagaacctcttgttggatcctgatacagctgtcttaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctccagtatagatgta
tggtctgcaggctgtgtgttggctgagctgttactaggacaaccaatatttccaggggac
agtggtgtggatcaattggtggaaataatcaaggtcctggggacaccaacaagggagcaa
attagagaaatgaaccccaactacacagaattcaaattccctcaaattaaggcacatcct
tggactaaggattcgtcaggaacaggacatttcacctcaggagtgcgggtcttccgaccc
cgaacgccaccggaggcaattgcactgtgtagccgtctgctggagtatacaccaactgcc
cgattgacaccactggaagcttgtgcacattcattttttgatgaattaagggacccaaat
gtcaaactaccaaatgggcgagacacacctgcactcttcaacttcaccactcaagaactg
tcaagtaatccacctctagctaccatccttattcctcctcatgctcggattcaagcagct
gcttcaacccctacaaatgccacagcagcctcagatgctaatgccggagaccgtggacag
accaacaatgtcgcttctgcatcagcttccaactccacctga

DBGET integrated database retrieval system