KEGG   Ailuropoda melanoleuca (giant panda): 100479295
Entry
100479295         CDS       T01329                                 

Gene name
PTTG1
Definition
(RefSeq) securin isoform X1
  KO
K06635  securin
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04110  Cell cycle
aml04114  Oocyte meiosis
aml05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:aml00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100479295 (PTTG1)
   04114 Oocyte meiosis
    100479295 (PTTG1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100479295 (PTTG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aml03036]
    100479295 (PTTG1)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Securin
    100479295 (PTTG1)
SSDB
Motif
Pfam: Securin
Other DBs
NCBI-GeneID: 100479295
NCBI-ProteinID: XP_011217790
Ensembl: ENSAMEG00000006653
UniProt: G1LJB4
LinkDB
Position
3
AA seq 201 aa
MATLIFVDKENGEPGTRVAPKDGLKPGSRPPVKALDGRSQVSTPRVGKTFDAQAALPKVA
RKALGTVNRATENSGKTNGPLKQKQPTFSAKKVTEKMVKAKSSVPASDDTYPEIEKFFPF
NPLDFESFDLPEEHQIAHLPLNGVPLMILNEERELEKLLHLGPPSPLKMPSPPWESNLLQ
SPSILSTLDVELPPVCYDLDI
NT seq 606 nt   +upstreamnt  +downstreamnt
atggctaccctgatctttgtggataaggaaaatggagaaccaggtacccgtgtggctccc
aaggacgggctgaagccgggatctaggcctccagtcaaagctttagatgggagatctcag
gtttcaacaccacgtgtaggcaaaacgtttgatgctcaagcagccttacctaaagttgcc
agaaaggctttgggaactgtcaacagagccacagaaaattcaggaaagactaatggacct
ctcaaacagaagcagccaaccttctctgccaaaaaggtgactgagaagatggtcaaagca
aaaagctctgttcctgcctcggatgacacctatccagaaatagaaaaattctttcccttc
aatcctttagattttgagagttttgacctccctgaagagcaccagattgcacacctcccc
ttgaatggagtgcctctcatgatcctcaatgaggagagggagcttgaaaagctgttacac
ctgggccccccttcacctctgaagatgccctctccaccatgggagtctaatctgttgcag
tctccaagcattctgtcgaccctggatgttgaattgccacctgtttgctatgacttagat
atttaa

DBGET integrated database retrieval system