KEGG   Ailuropoda melanoleuca (giant panda): 100479494
Entry
100479494         CDS       T01329                                 

Gene name
LTBR
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 3 isoform X1
  KO
K03159  lymphotoxin beta receptor TNFR superfamily member 3
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04060  Cytokine-cytokine receptor interaction
aml04061  Viral protein interaction with cytokine and cytokine receptor
aml04064  NF-kappa B signaling pathway
aml04066  HIF-1 signaling pathway
aml04672  Intestinal immune network for IgA production
aml05166  Human T-cell leukemia virus 1 infection
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100479494 (LTBR)
   04066 HIF-1 signaling pathway
    100479494 (LTBR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100479494 (LTBR)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100479494 (LTBR)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100479494 (LTBR)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100479494 (LTBR)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100479494 (LTBR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:aml04050]
    100479494 (LTBR)
Cytokine receptors [BR:aml04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100479494 (LTBR)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 100479494
NCBI-ProteinID: XP_002922295
Ensembl: ENSAMEG00000014476
LinkDB
Position
16
AA seq 428 aa
MRLPWAASPCGLAWGPLILGLCGLLAASQARLVREGPMQEPPYHTENQTCRDWEKEYYEP
KDQVCCSRCPPGTHVSEECSRSQDTICAVCPENSYNEHWNHLSICQLCRPCDQMLGFEET
VPCTSTQKTQCRCQPGMFCVHWDTECIHCEPLSDCPPGTEAELTDEVGVANRNCVPCKAG
HFQNTSSPRARCQPHTRCEERGLVEAVPGTAQSDSSCRNPPEHPEMPGTVMVLAILLPLA
SFLFLTTVLACTWKSHPSLCRKLGSLLKRRPEGEESNTADGSWEPPRVNPHFPDLVKPLL
PLSGAAAPPSARPQAPPSLEEEVLQQQSPFSQARELEPEPPEQGQVAHGTNGIHVTGGSV
TVTGNIYIYNGPVLGGARGPGDPPASPEPPYPTPEEGAPGPPGLSTPYQEDGKAWHLAET
ETLGCHAL
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgcgcctgccatgggctgcctccccctgcggcctggcctgggggccactcatcctgggc
ctctgcggtctcctggcggcatcccaggcccgactggtgagggaggggcccatgcaggag
cccccataccacacggagaaccaaacctgccgggactgggaaaaggagtactacgaaccc
aaggatcaggtctgctgctcccgctgccccccaggcacacacgtctccgaggaatgcagc
cgcagccaggacaccatttgtgccgtgtgtcccgaaaattcctacaacgagcactggaac
catctctccatctgccagctgtgccgcccctgtgaccagatgctgggcttcgaggagacc
gtgccttgcaccagcacgcagaaaacccagtgccgctgccagccgggaatgttctgcgtg
cactgggacacggagtgtatacactgcgagccactctccgactgcccgccgggcaccgaa
gccgagctgacagatgaagtcggggtggcgaacagaaactgtgtgccctgtaaggcaggc
cactttcagaacacctcctcccccagggcccgctgccagccccacacaaggtgtgaggag
cggggcctggtggaggcggttccaggcactgcccagtctgacagcagctgcagaaatcca
ccggagcaccctgagatgccaggaactgtgatggtgctggccatcctgctgccgctggcc
tcattcctgttcctcaccactgtcctggcctgcacctggaagagccacccctctctctgc
agaaagctgggatccctgctcaagaggcgtccagagggagaggaatcaaatactgctgat
ggaagctgggagcctccaagggtcaacccacatttccctgacctggtaaagccacttctg
cccctctctggagccgcggccccgccctcagccaggccccaagcacccccgagtttggag
gaagaagtgctacagcagcagagtccgttcagccaggccagggagctggagcctgagccc
ccggagcaaggccaggtggcccatggtaccaacggcattcatgtcaccggcgggtctgtg
actgtcaccggcaacatctacatctacaatgggccagtactggggggagcacggggcccc
ggagacccccctgcttccccagagcctccgtaccccacccctgaagagggtgcccctggc
cctcccgggctctctacaccctaccaggaggacggcaaggcttggcacctggctgaaaca
gagacactgggctgccatgccctctaa

DBGET integrated database retrieval system