KEGG   Ailuropoda melanoleuca (giant panda): 100479738
Entry
100479738         CDS       T01329                                 

Gene name
DDB2
Definition
(RefSeq) DNA damage-binding protein 2 isoform X1
  KO
K10140  DNA damage-binding protein 2
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml03420  Nucleotide excision repair
aml04115  p53 signaling pathway
aml04120  Ubiquitin mediated proteolysis
aml05161  Hepatitis B
aml05169  Epstein-Barr virus infection
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05210  Colorectal cancer
aml05212  Pancreatic cancer
aml05213  Endometrial cancer
aml05214  Glioma
aml05216  Thyroid cancer
aml05217  Basal cell carcinoma
aml05218  Melanoma
aml05220  Chronic myeloid leukemia
aml05222  Small cell lung cancer
aml05223  Non-small cell lung cancer
aml05224  Breast cancer
aml05225  Hepatocellular carcinoma
aml05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100479738 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100479738 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100479738 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100479738 (DDB2)
   05202 Transcriptional misregulation in cancer
    100479738 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100479738 (DDB2)
   05212 Pancreatic cancer
    100479738 (DDB2)
   05225 Hepatocellular carcinoma
    100479738 (DDB2)
   05226 Gastric cancer
    100479738 (DDB2)
   05214 Glioma
    100479738 (DDB2)
   05216 Thyroid cancer
    100479738 (DDB2)
   05220 Chronic myeloid leukemia
    100479738 (DDB2)
   05217 Basal cell carcinoma
    100479738 (DDB2)
   05218 Melanoma
    100479738 (DDB2)
   05213 Endometrial cancer
    100479738 (DDB2)
   05224 Breast cancer
    100479738 (DDB2)
   05222 Small cell lung cancer
    100479738 (DDB2)
   05223 Non-small cell lung cancer
    100479738 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100479738 (DDB2)
   05169 Epstein-Barr virus infection
    100479738 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:aml04121]
    100479738 (DDB2)
   03400 DNA repair and recombination proteins [BR:aml03400]
    100479738 (DDB2)
Ubiquitin system [BR:aml04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     100479738 (DDB2)
DNA repair and recombination proteins [BR:aml03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100479738 (DDB2)
SSDB
Motif
Pfam: WD40 EF-hand_1
Other DBs
NCBI-GeneID: 100479738
NCBI-ProteinID: XP_034502253
Ensembl: ENSAMEG00000007255
LinkDB
Position
16
AA seq 475 aa
MAPRKRPETQKTPEVSVRPKSKRSRSPRELEPEAKKLCVKGPGSSRRFDSGCLWAGLASL
QVPPPYSIVRALHQHKLGNTAWPSLQQGLQQAFLHSLASYRIFQKAAPFDRRATSLAWHP
THPSTLAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLDTNQFFTSSMEGTT
RLQDFKGNTLRVFTSSGTCNFWFCSLDVSARSRMVVTGDNVGHVILLNMDGRQLWNLRMH
KKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKSSFLHSLPHNHPVNAACFSPDGA
QLLTTDQKSELRVYSASQWDCPPSLIPHPHRHFQHLTPIKATWHPRYNLIVVGRYPDPNF
KSCTPHELRTIDVFDGNSGKMMYQLYDPESSGIISVRFGPSNDGRKQGFNLPSLTKNDQK
CVQSSRALLPIPHLLLMLMPLSLQLNEFNSMGDTLASVMGYHILIWSQEEAGRRT
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggctcctaggaaacgcccagaaacccagaagacccccgaggtgtctgtgcgccccaag
agcaagaggagcagaagcccccgggagctggagcccgaggccaagaagctctgtgtgaag
ggccccggttctagcagaagatttgactcgggctgcctttgggcggggttggctagcctg
caggtcccgccaccatacagcatcgtcagggccctccaccagcataagctgggcaacact
gcctggccatcgctacaacagggtctccagcaggcctttctgcactctctggcttcttac
cggatattccaaaaggctgccccctttgacaggagggccacatccttggcatggcaccca
actcaccccagcaccctggctgtgggttccaaagggggagatatcatgctctggaacttt
ggcataaaggacaaacccaccttcattaaagggattggagctggagggagcatcactggg
ctgaagtttaaccctcttgataccaaccagtttttcacctcctcaatggagggaacaact
aggctgcaagactttaaaggcaacacgctccgagtttttaccagctcaggcacctgcaac
ttctggttttgcagtctggatgtgtctgccagaagccgaatggtggtcacgggagacaat
gtggggcacgtgatcctgctgaacatggatggcaggcagctttggaatctgagaatgcac
aaaaagaaagtgacccacgtggccttgaacccatgctgtgattggttcctggccacagcc
tccgtagaccaaacagtgaaaatctgggacctgcgccaggttagagggaaatccagcttc
ctccactcgctgccgcataaccatcctgtcaacgcagcttgtttcagtcccgatggagcc
cagctcctgaccactgaccagaagagtgagctccgggtttattcggcctcccagtgggac
tgccctccgagcttgatcccacaccctcaccgccacttccagcacctgacgcccatcaag
gcaacctggcatcctcggtacaacctcattgtcgtgggccggtacccagatcctaatttc
aaaagctgtacaccccatgaattaaggaccatcgatgtgtttgatggaaactcagggaag
atgatgtatcagctctatgacccagaatcttctggtatcatttcggtgaggtttgggccc
tcaaatgatgggaggaagcagggcttcaacctaccttcactgaccaaaaacgaccagaaa
tgtgtgcagtcctcacgtgcgcttctcccaatacctcacctcctcctgatgcttatgccc
ttgtctctgcagctcaatgagttcaattccatgggggacacgctggcctctgtgatgggt
tatcacattctcatttggagccaggaggaagctggaaggcggacatga

DBGET integrated database retrieval system