KEGG   Ailuropoda melanoleuca (giant panda): 100479899Help
Entry
100479899         CDS       T01329                                 

Gene name
ADRA1A
Definition
(RefSeq) adrenoceptor alpha 1A
  KO
K04135  adrenergic receptor alpha-1A
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04020  Calcium signaling pathway
aml04022  cGMP-PKG signaling pathway
aml04080  Neuroactive ligand-receptor interaction
aml04152  AMPK signaling pathway
aml04261  Adrenergic signaling in cardiomyocytes
aml04270  Vascular smooth muscle contraction
aml04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100479899 (ADRA1A)
   04022 cGMP-PKG signaling pathway
    100479899 (ADRA1A)
   04152 AMPK signaling pathway
    100479899 (ADRA1A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100479899 (ADRA1A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100479899 (ADRA1A)
   04270 Vascular smooth muscle contraction
    100479899 (ADRA1A)
  09154 Digestive system
   04970 Salivary secretion
    100479899 (ADRA1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:aml04030]
    100479899 (ADRA1A)
G protein-coupled receptors [BR:aml04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    100479899 (ADRA1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 100479899
NCBI-ProteinID: XP_019649895
Ensembl: ENSAMEG00000000220
LinkDB All DBs
Position
Un
AA seq 466 aa AA seqDB search
MVFLSGNASDSSNCTHPPAPVNISKAILLGVILGGLIIFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQKRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQITE
EPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
VPVGGTGVSSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIAFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRKQSSKHILGYTL
HPPSHALEGQHKDLVRIPVGSGETFYKISKTDGVCEWKFFSSVPRESARITVSKDQSACT
TARVRSKSFLQVCCCVGPSTPSHGETHQVPTIKIHTISLSENGEEV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttctctctggaaatgcctccgacagttccaactgcacccacccgccggcaccg
gtgaacatatccaaggccattctgctcggggtgatcttggggggcctcatcattttcggc
gtgctgggcaacatcctcgtgatcctctctgtggcctgccaccggcatctgcactcggtc
actcactactacatcgtcaacctggcggtggccgacctcctgctcacctccaccgtgctg
cccttctcagctatcttcgagatcctgggctactgggcctttggcagagtcttctgcaat
atctgggcggcggtggacgtcctgtgctgcaccgcgtccatcatggggctctgcatcatc
tccatcgaccgctatataggtgtgagctacccgctgcgctaccccaccatcgtcacccag
aagaggggtctcatggctctgctctgtgtctgggcgctttccctcgtcatctccatcggg
cctctctttggctggaggcagccggccccggaggacgagaccatctgccagatcaccgag
gagccgggctacgtgctcttctcggcgctgggctccttctacgtgccgctgaccattatc
ctggtcatgtattgccgggtctacgtggtggccaagagggaaagcaggggcctcaagtct
ggcctcaagaccgacaagtcggactcggagcaggtgacgctccgcatccatcggaaaaat
gtcccagtaggaggcaccggggtgtccagcgccaagaacaagacgcacttctccgtgagg
ctcctcaagttttcccgggagaagaaagcggccaaaacactgggcatcgtggtcggctgc
ttcgtcctctgctggctgccttttttcttagtgatgcccattgggtctttcttccctgat
ttcaagccctcagaaacagtttttaaaatagcattttggctcggatacctaaacagctgc
atcaaccccattatatacccgtgctccagtcaagagtttaaaaaggcctttcagaatgtc
ttgagaatccagtgtctccgcagaaagcagtcttctaaacatatcctgggctataccctg
cacccgcccagccacgccctggaggggcagcacaaggacctggtgcgcatcccagtggga
tcaggagagaccttctataagatctccaagacggatggggtctgtgaatggaaatttttc
tcttcagtgccccgtgaatctgccaggattacagtgtccaaagaccagtcagcctgcacc
acagcccgggtgagaagtaaaagctttttgcaggtgtgctgctgtgtggggccctcgacc
cccagccatggagagacccaccaagttccaaccattaagatccacaccatctccctcagt
gaaaatggggaggaagtctag

DBGET integrated database retrieval system