KEGG   Ailuropoda melanoleuca (giant panda): 100479926
Entry
100479926         CDS       T01329                                 

Gene name
TNFRSF1A
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 1A
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04010  MAPK signaling pathway
aml04060  Cytokine-cytokine receptor interaction
aml04061  Viral protein interaction with cytokine and cytokine receptor
aml04064  NF-kappa B signaling pathway
aml04071  Sphingolipid signaling pathway
aml04150  mTOR signaling pathway
aml04210  Apoptosis
aml04215  Apoptosis - multiple species
aml04217  Necroptosis
aml04380  Osteoclast differentiation
aml04668  TNF signaling pathway
aml04920  Adipocytokine signaling pathway
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml05010  Alzheimer disease
aml05014  Amyotrophic lateral sclerosis
aml05022  Pathways of neurodegeneration - multiple diseases
aml05132  Salmonella infection
aml05142  Chagas disease
aml05145  Toxoplasmosis
aml05152  Tuberculosis
aml05160  Hepatitis C
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05170  Human immunodeficiency virus 1 infection
aml05171  Coronavirus disease - COVID-19
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100479926 (TNFRSF1A)
   04064 NF-kappa B signaling pathway
    100479926 (TNFRSF1A)
   04668 TNF signaling pathway
    100479926 (TNFRSF1A)
   04071 Sphingolipid signaling pathway
    100479926 (TNFRSF1A)
   04150 mTOR signaling pathway
    100479926 (TNFRSF1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100479926 (TNFRSF1A)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100479926 (TNFRSF1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100479926 (TNFRSF1A)
   04215 Apoptosis - multiple species
    100479926 (TNFRSF1A)
   04217 Necroptosis
    100479926 (TNFRSF1A)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100479926 (TNFRSF1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100479926 (TNFRSF1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100479926 (TNFRSF1A)
   05014 Amyotrophic lateral sclerosis
    100479926 (TNFRSF1A)
   05022 Pathways of neurodegeneration - multiple diseases
    100479926 (TNFRSF1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100479926 (TNFRSF1A)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100479926 (TNFRSF1A)
   04931 Insulin resistance
    100479926 (TNFRSF1A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100479926 (TNFRSF1A)
   05152 Tuberculosis
    100479926 (TNFRSF1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100479926 (TNFRSF1A)
   05170 Human immunodeficiency virus 1 infection
    100479926 (TNFRSF1A)
   05160 Hepatitis C
    100479926 (TNFRSF1A)
   05171 Coronavirus disease - COVID-19
    100479926 (TNFRSF1A)
   05164 Influenza A
    100479926 (TNFRSF1A)
   05168 Herpes simplex virus 1 infection
    100479926 (TNFRSF1A)
   05163 Human cytomegalovirus infection
    100479926 (TNFRSF1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100479926 (TNFRSF1A)
   05165 Human papillomavirus infection
    100479926 (TNFRSF1A)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100479926 (TNFRSF1A)
   05142 Chagas disease
    100479926 (TNFRSF1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:aml04050]
    100479926 (TNFRSF1A)
   04090 CD molecules [BR:aml04090]
    100479926 (TNFRSF1A)
Cytokine receptors [BR:aml04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100479926 (TNFRSF1A)
CD molecules [BR:aml04090]
 Proteins
  100479926 (TNFRSF1A)
SSDB
Motif
Pfam: Death TNFR_c6
Other DBs
NCBI-GeneID: 100479926
NCBI-ProteinID: XP_034500993
LinkDB
Position
16
AA seq 464 aa
MGLPAVPGLLLPLVLLALLVEIYPLQVTALVPLLRDREKRAILCPQGKYIHPRDNSICCT
KCHKGTYLYDDCPGSGLDTDCRECENGTFTASENHLRQCLSCSKCRKEMNQMEISPCTVY
RDTVCGCRENQYRYYWSDTLFQCVNCSLCLNGTVQISCKEKQNTVCTCHAGFFLRENECV
SCVHCKKNTDCTKLCLPPMETVKDPQDPGTTVLLPLVVIFGICVLSFSVVLMCRYQRQKP
RFFSIVCGKSTPTKEGEPETVASVPGFSPTTSFSPTTSFSPTTGFSPTTGFTPIPNPTFT
PRSVFTPGDWFKFRAASVSGEMAPPHQEAGPILTAAPTSTPIPTPVQKWEDSTHAQRPEA
DPADPATLYAVVDGVPPSRWKEFVRRLGLSEHEIERLELQNGRCLREAHYSMLAAWRRRT
PRREATLELLGRVLRDMDLLGCLEDIEEALCAPASLSPAPRLQR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgggcctccccgccgtgcccggcctgctgctgccactggtgctcctggctctgttggtg
gaaatataccccttacaggttacggcactggtccctctcctcagggaccgggagaagaga
gctattctgtgtcctcaaggaaaatatattcaccctcgagataattccatttgctgtaca
aagtgccacaaagggacctacctgtatgatgactgtcctggctcagggctggacacggac
tgcagggaatgtgaaaacggcaccttcacagcttccgagaaccacctcagacagtgcctc
agctgctccaaatgccgcaaagaaatgaaccagatggagatttctccttgcaccgtgtac
cgggacaccgtgtgtggctgccgggagaaccagtaccgctattactggagtgacaccctt
ttccagtgcgtgaactgcagcctctgcctcaatggcacggtgcagatctcctgtaaggag
aaacagaacaccgtgtgcacctgccacgcaggcttctttctaagagagaatgagtgcgtc
tcttgtgttcactgtaagaaaaacacagactgcacgaagttgtgtctacccccaatggaa
acggttaaggaccctcaggacccaggtaccacagtgctgttgcccctggtggtgatcttt
ggtatttgcgttttatccttctccgttgttttaatgtgccgctaccaaaggcagaagccc
aggttcttctccattgtttgtgggaaatcgacacctacaaaggagggggagcctgagacc
gtggcctccgttccaggtttcagtcccaccacgagcttcagtcccaccacgagcttcagt
cccaccacgggcttcagtcccaccacgggcttcactcccatccccaaccccaccttcacc
cccaggtccgtcttcacccctggtgactggtttaagttcagggctgcatcagtctctgga
gagatggctccaccccaccaggaggctggccctatcctcaccgcggctccaacctccacc
cctatccccacccctgttcagaagtgggaggacagcacccacgctcaacgcccagaagcc
gacccggcggacccggcgacgctgtatgccgtggtggacggcgtgcccccgtcgcgctgg
aaggagttcgtgcggcggctggggctgagcgagcacgagatcgagcggctggagctgcag
aacgggcgctgcctgcgggaggcgcactacagcatgctggcggcctggcggcggcgcacc
ccgcggcgcgaggccacgctggagctgctgggccgcgtgctccgcgacatggacctgctc
ggctgcctggaggacatcgaggaggcgctgtgcgcccccgcctccctctcgccggcgccc
cgcctccagcgatga

DBGET integrated database retrieval system