KEGG   Ailuropoda melanoleuca (giant panda): 100480054
Entry
100480054         CDS       T01329                                 

Gene name
BCL6
Definition
(RefSeq) B-cell lymphoma 6 protein isoform X1
  KO
K15618  B-cell lymphoma 6 protein
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04068  FoxO signaling pathway
aml05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100480054 (BCL6)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100480054 (BCL6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100480054 (BCL6)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    100480054 (BCL6)
SSDB
Motif
Pfam: BTB zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-met zf-C2H2_jaz DZR zf-C2HE zf-C2H2_6 DUF3342 Zn-ribbon_8
Other DBs
NCBI-GeneID: 100480054
NCBI-ProteinID: XP_002914850
Ensembl: ENSAMEG00000000812
UniProt: D2H065
LinkDB
Position
1
AA seq 706 aa
MASPADSCIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFYSI
FTDQLKCNLSVINLDPEINPEGFCILLDFMYTSRLNLREGNIMAVMAAAMYLQMEHVVDT
CRKFIKASEAEMVPAIKPPREEFLNSRMLMPQDIMAYRGREVVENNLPLRNAPGCESRAF
APSLYSGLSTPPASYPVYSHLPVSSFLFSDEELRDARMPVANPFPKERAHPCDSARPVPG
DYSRPAVELSPGVCHSIIYSPKEAAPEETRSDMHYGVAEGPKPAVPSARNAPYFPCDKAG
KEEERPSSEDEIALHFEPPSAPLNRKGLVSPQSPQKSDCQPNSPTESCSSKNACILQTSG
SPPAKSPTDPKACNWKKYKFIVLNSLNQNAKPEGPEQAELGRLSPRAYTAPPACQPPMEP
EGLDLQSPTKLSASGEDSTIPQASRLNNIVNRSLTGSPRSSSESHSPLYLHPPKCTSCGS
QSPQHAEMCLHTAGPTFPEEMGETQSEYSDSSCENGAFFCNECDCRFSEEASLKRHTLQT
HSDKPYKCDRCQASFRYKGNLASHKTVHTGEKPYRCNICGAQFNRPANLKTHTRIHSGEK
PYKCETCGARFVQVAHLRAHVLIHTGEKPYPCEICGTRFRHLQTLKSHLRIHTGEKPYHC
EKCNLHFRHKSQLRLHLRQKHGAITNTKVQYRVSATDLPPELPKAC
NT seq 2121 nt   +upstreamnt  +downstreamnt
atggcctccccggctgacagctgtatccagttcacgcgccacgccagtgacgttcttctc
aaccttaatcgcctccggagccgtgacatcttgactgatgttgtcatcgtggtgagccgt
gagcagttcagagcccataagacagtcctcatggcctgcagtggcctgttctacagcatc
ttcacagaccagctgaagtgtaacctgagtgtgattaacctggatcccgagatcaacccc
gagggtttctgcatcctcctggacttcatgtacacgtcccggctcaatctgcgggagggc
aacatcatggccgtcatggccgcggccatgtacctgcagatggagcacgtcgtggacact
tgccggaagtttatcaaggccagtgaagcagagatggttcctgccatcaagcctccccgt
gaagagttcctgaatagccgaatgctgatgccccaagacatcatggcctatcggggccgt
gaggtggtggagaataatctgccgctgaggaacgcccccggctgcgagagcagagccttc
gcccccagcctgtacagcggcctgtccaccccaccggcctcttaccccgtctacagtcac
ctccccgtcagcagcttcctcttctccgacgaggagctgcgggatgcccggatgcctgtg
gccaaccccttccctaaggagcgggcccacccctgcgacagtgccaggcccgtccccggg
gactacagccggccggccgtggagctatctcccggtgtgtgccacagcatcatctactca
cccaaggaggcggccccggaggagacacgcagtgacatgcactacggcgtggccgagggc
cccaagcccgccgtcccctcggcccggaatgccccgtacttcccctgtgacaaggctggc
aaggaggaagagaggccctcctcagaggatgagatcgccctgcatttcgagccccccagt
gcacccctgaaccgcaagggtctggtcagtccacagagcccccagaagtccgactgccag
cccaactcgcccacggagtcctgcagcagcaagaatgcctgcatcctccagacctccggt
tcccctccagccaagagccccaccgaccccaaagcctgcaactggaagaaatacaagttc
attgtgctcaacagcctcaaccagaatgccaaaccggaggggcccgagcaggccgagctg
ggccgcctttcccctcgagcctacaccgccccaccggcctgccagccacccatggagccc
gagggccttgacctccagtccccaaccaagctcagcgccagcggggaggactccaccatc
ccacaggccagccggctcaataacattgtcaacaggtccctgacaggctccccccgcagc
agcagcgagagccactcaccgctctacttgcacccccccaagtgcacgtcctgcggctct
cagtccccacagcacgcagagatgtgcctccataccgccggccccacattccccgaggag
atgggagagacccagtctgagtactcggattccagctgtgagaacggggccttcttttgc
aatgagtgtgactgccgcttctctgaggaggcctcactcaagagacacacgctgcagacc
cacagtgacaaaccctacaagtgtgaccgctgccaggcctccttccgctacaagggcaac
ctcgccagccacaagaccgtccatacgggtgagaaaccctatcgttgtaacatttgtgga
gcccagttcaaccggccagccaacctgaaaacccacactcgaattcactctggagagaag
ccctacaaatgcgaaacctgtggggccagatttgtacaagtggcccacctccgtgcccat
gtgctcatccacactggagagaagccctatccctgtgaaatctgtggcacccgtttccgg
cacctgcagactctgaaaagccatctgcgaatccacacaggagagaaaccttatcattgc
gagaagtgcaacctgcatttccgtcacaaaagccagctgcgtcttcacttgcgccagaag
cacggcgccatcaccaacaccaaggtgcaataccgcgtgtccgccactgacctgcccccg
gagctccccaaagcctgctga

DBGET integrated database retrieval system