KEGG   Ailuropoda melanoleuca (giant panda): 100480115Help
Entry
100480115         CDS       T01329                                 

Gene name
PAX8
Definition
(RefSeq) paired box 8
  KO
K09293  paired box protein 8
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04918  Thyroid hormone synthesis
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    100480115 (PAX8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100480115 (PAX8)
   05202 Transcriptional misregulation in cancer
    100480115 (PAX8)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100480115 (PAX8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100480115 (PAX8)
Transcription factors [BR:aml03000]
 Eukaryotic Type
  Helix-turn-helix
   Paired box domain only
    100480115 (PAX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAX Pax2_C HTH_23 HTH_32 HTH_28 HTH_Tnp_IS1
Motif
Other DBs
NCBI-GeneID: 100480115
NCBI-ProteinID: XP_011232038
Ensembl: ENSAMEG00000010662
LinkDB All DBs
Position
Un
AA seq 485 aa AA seqDB search
MACGHEKPVEGAQKWAIWDVLPAVVEKHVLGQAASCHGGLNQLGGAFVNGRPLPEVVRQR
IVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIG
DYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSCVATKSL
SPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDSKRKMDDSDQDSCRLSIDS
QSSSSGPRKHPRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTAL
DDGKATLTPSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLD
LQQVGSGVPAGASVPPFNAFPHAASVYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGS
YASSAIAGMVAGSEYSGSAYGHTPYSSYGEAWRFPNSSLLSSPYYYSSTSRPSAPPTTAT
AFDHL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggcctgtggccatgagaagccagtggaaggggctcagaagtgggccatctgggatgtc
ctcccagccgtggtggaaaagcacgtgctgggacaagcggcctcatgccacggagggctg
aaccagctgggaggggcctttgtgaacggcagacccctgcccgaggtggtgcgtcaacgc
atcgtggacctggcccaccagggggtgaggccctgcgacatctcccgccagctccgagtc
agccatggctgtgtcagcaagatccttggcaggtactacgagaccggcagcatccggcct
ggagtgatagggggctccaagcccaaggtggctacccccaaggtggtggagaagattgga
gactacaagcggcagaaccccaccatgtttgcctgggagatccgagaccggctcctggcg
gagggggtctgtgacaatgacactgtgcccagtgtcagctccatcaacagaatcatccgg
accaaagtgcagcaaccgttcaacctccccatggacagctgcgtggccaccaagtccctg
agcccaggacatacgctgatccccagctcagccgtcacgcccccggagtcaccccagtcg
gactccctgggctccacctactccatcaatgggctcctggggatcgctcagcctggcagc
gacagcaagaggaaaatggacgacagtgaccaggacagctgccggctgagcatcgactcc
cagagcagcagcagcgggccccgcaagcacccacgcacggacgccttcagccagcaccac
cttgagccgctcgagtgcccgttcgagcggcagcactacccggaggcctatgcctccccc
agccacaccaaaggcgagcagggcctctacccgctgcccttgctcaacagcaccgccctg
gacgatggcaaggctaccctgaccccttccaacacgcccttggggcgcaacctctcgact
caccagacctacccagtggtggcagatcctcattcacccttcgccataaagcaggaaacc
cccgaggtgtccagttctagctccaccccttcctctttatctagctccgcctttttggat
ctgcagcaagtcggctccggggtcccagccggtgcctcggtcccgcccttcaatgccttt
ccccatgctgcctccgtgtacgggcagttcacgggccaggccctcctctcagggagagag
atggtgggacccacgctgcccggatacccaccccacatccccaccagcggacagggcagc
tatgcctcttctgccatcgcaggcatggtggcaggaagtgaatactctggcagtgcctac
ggccacactccctactcctcctacggcgaggcctggcgcttccccaactccagcttgctg
agttccccatattattacagttccacatcaaggccaagtgcgccacccaccaccgccacg
gcctttgaccatctgtag

DBGET integrated database retrieval system