KEGG   Ailuropoda melanoleuca (giant panda): 100480115
Entry
100480115         CDS       T01329                                 

Definition
(RefSeq) paired box protein Pax-8
  KO
K09293  paired box protein 8
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04918  Thyroid hormone synthesis
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    100480115
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100480115
   05202 Transcriptional misregulation in cancer
    100480115
  09162 Cancer: specific types
   05216 Thyroid cancer
    100480115
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100480115
Transcription factors [BR:aml03000]
 Eukaryotic type
  Helix-turn-helix
   Paired box domain only
    100480115
SSDB
Motif
Pfam: PAX Pax2_C HTH_23 HTH_32 HTH_Tnp_IS1
Other DBs
NCBI-GeneID: 100480115
NCBI-ProteinID: XP_034513176
Ensembl: ENSAMEG00000010662
LinkDB
Position
4
AA seq 439 aa
MACGHEKPVEGAQKWAIWDVLPAVVEKHIRKSKPERRGDVLQHHAAQHQSHGGLNQLGGA
FVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGS
KPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQP
FNLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDSKRKM
DDSDQDSCRLSIDSQSSSSGPRKHPRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGE
QGLYPLPLLNSTALDDGKATLTPSNTPLGRNLSTHQTYPVVAADPHSPFAIKQETPEVSS
SSSTPSSLSSSAFLDLQQVGSGVPAGASVPPFNAFPHAASVYGQFTGQALLSGTTGRSWA
ILDKKLKESQQIEGEHKVG
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggcctgtggccatgagaagccagtggaaggggctcagaagtgggccatctgggatgtc
ctcccagccgtggtggaaaagcacataaggaaaagcaagccagagaggagaggggacgtt
ctccagcatcacgcagctcagcaccagagccacggagggctgaaccagctgggaggggcc
tttgtgaacggcagacccctgcccgaggtggtgcgtcaacgcatcgtggacctggcccac
cagggggtgaggccctgcgacatctcccgccagctccgagtcagccatggctgtgtcagc
aagatccttggcaggtactacgagaccggcagcatccggcctggagtgatagggggctcc
aagcccaaggtggctacccccaaggtggtggagaagattggagactacaagcggcagaac
cccaccatgtttgcctgggagatccgagaccggctcctggcggagggggtctgtgacaat
gacactgtgcccagtgtcagctccatcaacagaatcatccggaccaaagtgcagcaaccg
ttcaacctccccatggacagctgcgtggccaccaagtccctgagcccaggacatacgctg
atccccagctcagccgtcacgcccccggagtcaccccagtcggactccctgggctccacc
tactccatcaatgggctcctggggatcgctcagcctggcagcgacagcaagaggaaaatg
gacgacagtgaccaggacagctgccggctgagcatcgactcccagagcagcagcagcggg
ccccgcaagcacccacgcacggacgccttcagccagcaccaccttgagccgctcgagtgc
ccgttcgagcggcagcactacccggaggcctatgcctcccccagccacaccaaaggcgag
cagggcctctacccgctgcccttgctcaacagcaccgccctggacgatggcaaggctacc
ctgaccccttccaacacgcccttgggacgcaacctctcgactcaccagacctacccagtg
gtggcagcagatcctcattcacccttcgccataaagcaggaaacccccgaggtgtccagt
tctagctccaccccttcctctttatctagctccgcctttttggatctgcagcaagtcggc
tccggggtcccagccggtgcctcggtcccgcccttcaatgcctttccccatgctgcctcc
gtgtacgggcagttcacgggccaggccctcctctcaggtacgacagggaggtcctgggcc
atcttagacaagaagctgaaagaaagccagcagatagaaggggagcacaaggtgggctga

KEGG   Ailuropoda melanoleuca (giant panda): 100482938
Entry
100482938         CDS       T01329                                 

Gene name
PPARG
Definition
(RefSeq) peroxisome proliferator-activated receptor gamma isoform X1
  KO
K08530  peroxisome proliferator-activated receptor gamma
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml03320  PPAR signaling pathway
aml04152  AMPK signaling pathway
aml04211  Longevity regulating pathway
aml04380  Osteoclast differentiation
aml04714  Thermogenesis
aml05016  Huntington disease
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    100482938 (PPARG)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100482938 (PPARG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100482938 (PPARG)
  09149 Aging
   04211 Longevity regulating pathway
    100482938 (PPARG)
  09159 Environmental adaptation
   04714 Thermogenesis
    100482938 (PPARG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100482938 (PPARG)
   05202 Transcriptional misregulation in cancer
    100482938 (PPARG)
  09162 Cancer: specific types
   05216 Thyroid cancer
    100482938 (PPARG)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100482938 (PPARG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100482938 (PPARG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:aml03310]
    100482938 (PPARG)
Transcription factors [BR:aml03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    100482938 (PPARG)
Nuclear receptors [BR:aml03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   100482938 (PPARG)
SSDB
Motif
Pfam: PPARgamma_N zf-C4 Hormone_recep Tmemb_55A
Other DBs
NCBI-GeneID: 100482938
NCBI-ProteinID: XP_011225831
Ensembl: ENSAMEG00000004774
LinkDB
Position
4
AA seq 475 aa
MVDTEMPFWPTNFGISSVDLSVMDDHSHSFDIKPFTTVDFSSISTPHYEDIPFARADPMV
ADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFH
YGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRF
GRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTT
DKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKS
IPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGD
FMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLK
LNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
NT seq 1428 nt   +upstreamnt  +downstreamnt
atggttgacaccgagatgccattttggcccaccaactttggaatcagctccgtggatctc
tctgtaatggatgaccactcccattcttttgacatcaagcccttcaccactgtggatttc
tccagcatttccactccacactatgaagacattccatttgcaagagcagacccaatggtt
gctgattataagtatgacctgaagctccaagagtaccaaagtgcaatcaaagtggagcct
gcatccccaccttattattcggaaaagactcagctgtacaataagcctcatgaagagcct
tccaactccctcatggcaattgaatgccgagtctgtggagataaagcttccgggttccac
tacggcgttcatgcttgtgaaggatgcaaggggttcttccggaggacaatcagattgaag
ctcatttatgataggtgtgaccttaactgtcggatccataaaaaaagtagaaataaatgt
cagtactgtcggtttcagaaatgccttgctgtggggatgtctcacaatgccatcaggttt
gggcggatgccgcaggccgagaaggagaagctgttggcggagatctccagcgatatcgac
cagctgaacccagagtcggctgatctccgggccctggcaaaacatttgtatgactcatac
ataaagtcctttccgctgaccaaagcaaaggcgagggcgatcttgacaggaaagacaacg
gacaaatcaccatttgttatctatgacatgaattccttaatgatgggagaagataaaatc
aagttcaaacacatcacccccttgcaggagcagagcaaagaagtggccattcgcatcttt
caggggtgtcagttccgctcagtggaagctgtgcaggagatcacagagtatgccaaaagt
atccctggctttgtaaaccttgacttgaatgaccaagtaactctcctaaaatatggtgtc
catgagatcatttacacgatgctggcctccttgatgaataaagatggggttctcatatca
gagggccaaggattcatgacaagggagtttctaaagagcctgagaaagccctttggtgac
tttatggagcccaagtttgagtttgctgtgaagttcaatgcactggaattagatgacagc
gacttggcaatatttatagccgtcattattctcagtggagaccgcccaggtttgctgaac
gtgaagcccattgaggacatccaggacaacctgctgcaagccttggagctccagctcaag
ctgaaccacccagagtcctctcagctctttgccaagctgctccagaaaatgacagacctc
agacagattgtaacggaacatgtgcagctattgcaagtcataaagaaaacagagacagac
atgagtcttcacccactcctacaagagatatacaaggacttgtattag

DBGET integrated database retrieval system