KEGG   Ailuropoda melanoleuca (giant panda): 100480158
Entry
100480158         CDS       T01329                                 

Gene name
RELA
Definition
(RefSeq) transcription factor p65 isoform X1
  KO
K04735  transcription factor p65
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml01523  Antifolate resistance
aml04010  MAPK signaling pathway
aml04014  Ras signaling pathway
aml04024  cAMP signaling pathway
aml04062  Chemokine signaling pathway
aml04064  NF-kappa B signaling pathway
aml04066  HIF-1 signaling pathway
aml04071  Sphingolipid signaling pathway
aml04137  Mitophagy - animal
aml04151  PI3K-Akt signaling pathway
aml04210  Apoptosis
aml04211  Longevity regulating pathway
aml04218  Cellular senescence
aml04380  Osteoclast differentiation
aml04620  Toll-like receptor signaling pathway
aml04621  NOD-like receptor signaling pathway
aml04622  RIG-I-like receptor signaling pathway
aml04623  Cytosolic DNA-sensing pathway
aml04625  C-type lectin receptor signaling pathway
aml04657  IL-17 signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04659  Th17 cell differentiation
aml04660  T cell receptor signaling pathway
aml04662  B cell receptor signaling pathway
aml04668  TNF signaling pathway
aml04722  Neurotrophin signaling pathway
aml04917  Prolactin signaling pathway
aml04920  Adipocytokine signaling pathway
aml04926  Relaxin signaling pathway
aml04931  Insulin resistance
aml04932  Non-alcoholic fatty liver disease
aml04933  AGE-RAGE signaling pathway in diabetic complications
aml05010  Alzheimer disease
aml05022  Pathways of neurodegeneration - multiple diseases
aml05030  Cocaine addiction
aml05132  Salmonella infection
aml05133  Pertussis
aml05134  Legionellosis
aml05135  Yersinia infection
aml05140  Leishmaniasis
aml05142  Chagas disease
aml05145  Toxoplasmosis
aml05146  Amoebiasis
aml05152  Tuberculosis
aml05160  Hepatitis C
aml05161  Hepatitis B
aml05162  Measles
aml05163  Human cytomegalovirus infection
aml05164  Influenza A
aml05165  Human papillomavirus infection
aml05166  Human T-cell leukemia virus 1 infection
aml05167  Kaposi sarcoma-associated herpesvirus infection
aml05168  Herpes simplex virus 1 infection
aml05169  Epstein-Barr virus infection
aml05170  Human immunodeficiency virus 1 infection
aml05200  Pathways in cancer
aml05202  Transcriptional misregulation in cancer
aml05203  Viral carcinogenesis
aml05212  Pancreatic cancer
aml05215  Prostate cancer
aml05220  Chronic myeloid leukemia
aml05221  Acute myeloid leukemia
aml05222  Small cell lung cancer
aml05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
aml05321  Inflammatory bowel disease
aml05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100480158 (RELA)
   04014 Ras signaling pathway
    100480158 (RELA)
   04064 NF-kappa B signaling pathway
    100480158 (RELA)
   04668 TNF signaling pathway
    100480158 (RELA)
   04066 HIF-1 signaling pathway
    100480158 (RELA)
   04071 Sphingolipid signaling pathway
    100480158 (RELA)
   04024 cAMP signaling pathway
    100480158 (RELA)
   04151 PI3K-Akt signaling pathway
    100480158 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100480158 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    100480158 (RELA)
   04218 Cellular senescence
    100480158 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100480158 (RELA)
   04621 NOD-like receptor signaling pathway
    100480158 (RELA)
   04622 RIG-I-like receptor signaling pathway
    100480158 (RELA)
   04623 Cytosolic DNA-sensing pathway
    100480158 (RELA)
   04625 C-type lectin receptor signaling pathway
    100480158 (RELA)
   04660 T cell receptor signaling pathway
    100480158 (RELA)
   04658 Th1 and Th2 cell differentiation
    100480158 (RELA)
   04659 Th17 cell differentiation
    100480158 (RELA)
   04657 IL-17 signaling pathway
    100480158 (RELA)
   04662 B cell receptor signaling pathway
    100480158 (RELA)
   04062 Chemokine signaling pathway
    100480158 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100480158 (RELA)
   04917 Prolactin signaling pathway
    100480158 (RELA)
   04926 Relaxin signaling pathway
    100480158 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100480158 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100480158 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    100480158 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100480158 (RELA)
   05202 Transcriptional misregulation in cancer
    100480158 (RELA)
   05203 Viral carcinogenesis
    100480158 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100480158 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100480158 (RELA)
   05221 Acute myeloid leukemia
    100480158 (RELA)
   05220 Chronic myeloid leukemia
    100480158 (RELA)
   05215 Prostate cancer
    100480158 (RELA)
   05222 Small cell lung cancer
    100480158 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100480158 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100480158 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    100480158 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    100480158 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100480158 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100480158 (RELA)
   04931 Insulin resistance
    100480158 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100480158 (RELA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100480158 (RELA)
   05135 Yersinia infection
    100480158 (RELA)
   05133 Pertussis
    100480158 (RELA)
   05134 Legionellosis
    100480158 (RELA)
   05152 Tuberculosis
    100480158 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100480158 (RELA)
   05170 Human immunodeficiency virus 1 infection
    100480158 (RELA)
   05162 Measles
    100480158 (RELA)
   05164 Influenza A
    100480158 (RELA)
   05161 Hepatitis B
    100480158 (RELA)
   05160 Hepatitis C
    100480158 (RELA)
   05168 Herpes simplex virus 1 infection
    100480158 (RELA)
   05163 Human cytomegalovirus infection
    100480158 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100480158 (RELA)
   05169 Epstein-Barr virus infection
    100480158 (RELA)
   05165 Human papillomavirus infection
    100480158 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100480158 (RELA)
   05145 Toxoplasmosis
    100480158 (RELA)
   05140 Leishmaniasis
    100480158 (RELA)
   05142 Chagas disease
    100480158 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    100480158 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aml03000]
    100480158 (RELA)
Transcription factors [BR:aml03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    100480158 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 100480158
NCBI-ProteinID: XP_019652454
Ensembl: ENSAMEG00000017369
LinkDB
Position
16
AA seq 570 aa
MPSLSFPYGSRTGPDSVSLSKERALYPVFPQETDLFPLIFPSEPAQASGPYVEIIEQPKQ
RGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHE
LVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQR
GDYDLNAVRLCFQVTVRDPAGRPLRLSPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGG
DEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVS
MQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFNGPTDPRPPPR
RIAVPSRSTPSVPKPAPQPYPFTPSLSTINFEEFSPMVFPSGQIPNQTSALAPAPAPILA
QAPAPAPAPILAPGLAQAVVPPIPKTTQAGEGTLSEALLHLQFDADEDLGALLGNSTDPA
VFTDLASVDNSEFQQLLNQGVSVAPHTAEPMLMEYPEAITRLVTGSQRPPDPAPAPLGAS
GLPNGLLSGDEDFSSIADMDFSALLSQISS
NT seq 1713 nt   +upstreamnt  +downstreamnt
atgccctccctcagttttccttatggaagtagaacaggcccagactccgtttccctcagt
aaggagagggcgctgtacccagttttccctcaggaaacagacctgtttcccctcatcttc
ccgtctgagcccgcccaggcctctggcccctatgtggagatcatcgagcagcccaagcag
cggggcatgcgcttccgctacaagtgcgagggccgctcagcgggcagtatcccgggcgag
aggagcacggataccaccaagacccaccccaccatcaagatcaatggctacactgggcca
gggacagttcgcatctccctggttaccaaggacccccctcaccggcctcacccccatgag
cttgtggggaaagactgccgggatggcttctatgaggctgagctctgccccgaccgttgc
atccacagcttccagaacctggggatccagtgtgtaaagaagcgggacctggagcaggcc
atcagtcaacgcatccagaccaacaacaatcccttccaagttcccatagaagaacagcgt
ggggactacgacctgaatgcggtgcggctgtgcttccaggtgacagtgcgggacccggca
ggcaggccccttcgcttgtcacccgtcctctctcatcccatctttgacaaccgtgccccc
aacaccgccgagctcaagatctgccgagtgaaccggaactctgggagctgccttgggggg
gatgagatcttcctgctgtgtgacaaggtgcagaaagaggacatcgaagtgtatttcacg
ggaccaggctgggaggcccgaggctccttttctcaagctgacgtccaccgacaagtggcc
attgtgttccggacacctccctacgcggaccccagcctgcaggcccccgtgcgtgtctcc
atgcagctgcggcggccttcagatcgggagctcagcgagcccatggaattccagtacttg
ccagacacagatgatcgacaccggattgaggagaaacgcaaaaggacgtatgagaccttc
aagagcatcatgaaaaagagtcctttcaatggacccaccgacccccgacctccaccccgg
cgcattgctgtgccttcccgaagcacaccttccgtccccaagccagctccccagccctat
ccctttacgccgtccctcagcaccatcaacttcgaggagttctcccccatggtctttcct
tcggggcagatcccaaaccagacctctgccttggccccagcccctgccccaatcctcgcc
caggccccagccccagcccctgccccgatcttagccccaggccttgctcaggctgtggtc
ccccccatccccaagaccacccaggccggggaagggacactgtcagaggccctgctgcac
ctgcagtttgacgccgacgaagacctgggggccctgctgggcaacagcactgaccccgcc
gtgttcacagacctggcatctgtcgacaactctgagtttcagcagctgctgaaccagggt
gtatctgtggccccccacacagccgagcccatgctgatggagtaccctgaggcaataacg
cgcctggtgacagggtcccagaggccccctgacccagctcctgctcccctgggggcctct
gggctccccaacggcctcctctcaggggatgaagacttctcctccattgcagacatggac
ttctcagcccttctgagtcagatcagctcctaa

DBGET integrated database retrieval system