KEGG   Ailuropoda melanoleuca (giant panda): 100480260
Entry
100480260         CDS       T01329                                 

Definition
(RefSeq) whey acidic protein
  KO
K17106  whey acidic protein
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:aml00001]
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100480260
SSDB
Motif
Pfam: WAP
Other DBs
NCBI-GeneID: 100480260
NCBI-ProteinID: XP_034521057
LinkDB
Position
1
AA seq 134 aa
MRSLASLTLALLALEATLALAPAPALTLPGQAVCPELSSSEEDACTVSCNSDESCPQGTK
CCARSPCSRSCVVPFIAPAQKAGRCPRIQASLISAPCLESNECSRDDQCADNRKCCLSAC
AMRCLEPEAEEPLQ
NT seq 405 nt   +upstreamnt  +downstreamnt
atgcgctctctcgccagcctaactctggccctgctggccctggaggccaccctggccctg
gccccggccccagccctcaccttgccagggcaggctgtgtgcccggagctcagctcctcg
gaggaggatgcctgcacggtctcctgcaactcggacgagagctgcccccaaggcaccaaa
tgctgcgccaggagcccctgcagccgctcctgcgtggtccccttcatcgctcccgcgcag
aaggcgggccgctgcccgcgcatccaggcctcactgatctccgcgccctgcttggagagc
aacgagtgttccagagacgaccagtgcgccgacaacaggaagtgttgcctcagcgcctgt
gccatgcggtgtctggagcccgaggcagaggaaccccttcagtga

DBGET integrated database retrieval system