KEGG   Ailuropoda melanoleuca (giant panda): 100480564
Entry
100480564         CDS       T01329                                 

Gene name
CDK1
Definition
(RefSeq) cyclin-dependent kinase 1 isoform X2
  KO
K02087  cyclin-dependent kinase 1 [EC:2.7.11.22 2.7.11.23]
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04110  Cell cycle
aml04114  Oocyte meiosis
aml04115  p53 signaling pathway
aml04218  Cellular senescence
aml04540  Gap junction
aml04914  Progesterone-mediated oocyte maturation
aml05170  Human immunodeficiency virus 1 infection
aml05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:aml00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100480564 (CDK1)
   04114 Oocyte meiosis
    100480564 (CDK1)
   04115 p53 signaling pathway
    100480564 (CDK1)
   04218 Cellular senescence
    100480564 (CDK1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100480564 (CDK1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100480564 (CDK1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100480564 (CDK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100480564 (CDK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aml01001]
    100480564 (CDK1)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:aml03032]
    100480564 (CDK1)
   03036 Chromosome and associated proteins [BR:aml03036]
    100480564 (CDK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aml04147]
    100480564 (CDK1)
Enzymes [BR:aml01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     100480564 (CDK1)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     100480564 (CDK1)
Protein kinases [BR:aml01001]
 Serine/threonine kinases: CMGC group
  CDK family
   100480564 (CDK1)
DNA replication proteins [BR:aml03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    100480564 (CDK1)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    100480564 (CDK1)
Exosome [BR:aml04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100480564 (CDK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Haspin_kinase
Other DBs
NCBI-GeneID: 100480564
NCBI-ProteinID: XP_019650652
LinkDB
Position
6
AA seq 110 aa
MEDYTKIEKIGEGTYGVVYKGRHKTTGQVVAMKKIRLESEEEGVPSTAIREISLLKELRH
PNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQFMDSSLVKILFI
NT seq 333 nt   +upstreamnt  +downstreamnt
atggaagattataccaaaatagagaaaattggagaaggtacctatggagttgtgtataag
ggtagacacaaaactacaggtcaagtggtagccatgaagaaaatcagactagaaagtgaa
gaggaaggggttcctagtactgcaattcgggaaatttctctattaaaagaacttcgtcat
ccaaatatagtcagtcttcaagatgtgcttatgcaagattccaggttatatctcatcttt
gaattcctttccatggatctcaagaaatacttagattccatccctcctggtcagttcatg
gattcttcacttgttaagattttatttatttga

DBGET integrated database retrieval system